(data stored in ACNUC7421 zone)

EMBL: CP001630.PE409

CP001630.PE409       Location/Qualifiers
FT   CDS             453387..453620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0416"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34383"
FT                   /db_xref="InterPro:IPR031795"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGR7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34383.1"
FT                   /translation="MPSRAFKWLPHDRSRHAVERGRHPGEDTRTLCGVDVTVPVQELPR
FT                   THWYWPTCVDCDAAWRGHEGIPAFPRTGEARR"
     MPSRAFKWLP HDRSRHAVER GRHPGEDTRT LCGVDVTVPV QELPRTHWYW PTCVDCDAAW        60
     RGHEGIPAFP RTGEARR                                                       77
//

If you have problems or comments...

PBIL Back to PBIL home page