(data stored in ACNUC7421 zone)

EMBL: CP001630.PE41

CP001630.PE41        Location/Qualifiers
FT   CDS             complement(45188..45736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0041"
FT                   /product="copper resistance protein CopC"
FT                   /note="PFAM: copper resistance protein CopC; KEGG:
FT                   bra:BRADO4155 copper resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34015"
FT                   /db_xref="GOA:C6WCJ4"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCJ4"
FT                   /inference="protein motif:PFAM:PF04234"
FT                   /protein_id="ACU34015.1"
FT                   /translation="MRRAVSLLLSALVAGGVALGAAPAAWAHNVLISSDPKDGAELATG
FT                   PREVTLTFDQPVQAGERFNTLTVTSADGTRWEDQAEPTVRDNSVIFPVRELGPAGEYTL
FT                   GYRILSADGHPVSGSLKFTTTTAAQGTPVPASESATRDASGGDSGGGVPVWVWIVGAVV
FT                   LLGGGVFFALRGGGDGADR"
     MRRAVSLLLS ALVAGGVALG AAPAAWAHNV LISSDPKDGA ELATGPREVT LTFDQPVQAG        60
     ERFNTLTVTS ADGTRWEDQA EPTVRDNSVI FPVRELGPAG EYTLGYRILS ADGHPVSGSL       120
     KFTTTTAAQG TPVPASESAT RDASGGDSGG GVPVWVWIVG AVVLLGGGVF FALRGGGDGA       180
     DR                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page