(data stored in ACNUC7421 zone)

EMBL: CP001630.PE411

CP001630.PE411       Location/Qualifiers
FT   CDS             complement(453918..454655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0418"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; NAD-dependent epimerase/dehydratase; KEGG:
FT                   bph:Bphy_4607 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34385"
FT                   /db_xref="GOA:C6WGR9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGR9"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACU34385.1"
FT                   /translation="MPGVLQDKVAVITGGSSGIGLAMAHRFAAEGARVFVTGRDAARLD
FT                   AAVAEIGDAATGVRADVADPAALDALYERVRAEAGRVDVLVANAGLAADAPLGEHTEEG
FT                   VDLTLAVNVKGTLFTVQKALPLLSAGASIIVIGSSNSTRPNPLLAVYSASKAAVRNLVR
FT                   NWAAQSKDRQFRINVLSPGPTRTPGLMSAGGPMIEQYVREQVPLGRMAEPEEIASAALF
FT                   LASDASSFVTGVELFADGGQAQV"
     MPGVLQDKVA VITGGSSGIG LAMAHRFAAE GARVFVTGRD AARLDAAVAE IGDAATGVRA        60
     DVADPAALDA LYERVRAEAG RVDVLVANAG LAADAPLGEH TEEGVDLTLA VNVKGTLFTV       120
     QKALPLLSAG ASIIVIGSSN STRPNPLLAV YSASKAAVRN LVRNWAAQSK DRQFRINVLS       180
     PGPTRTPGLM SAGGPMIEQY VREQVPLGRM AEPEEIASAA LFLASDASSF VTGVELFADG       240
     GQAQV                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page