(data stored in ACNUC7421 zone)

EMBL: CP001630.PE412

CP001630.PE412       Location/Qualifiers
FT   CDS             454677..455330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0419"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bxe:Bxe_B1146
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34386"
FT                   /db_xref="GOA:C6WGS0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGS0"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU34386.1"
FT                   /translation="MDRPKPSRLWTIESRTGSFGAVPRPRKFDETQVLELAREQFWTTG
FT                   FAGTRMDDIARVTGLGKGSLYGAFGDKEALFRRVFDDWCGAIVVLAEENLTGPDEGALA
FT                   RLEAYVRFVAANTAADVGRRGCFQAKGTAELAASDESVADRSATTMRALLGLLSREITA
FT                   AQRCGDLAPDADPDALASLLLVVVRGVEAVGKAGLGAEAVTSAADTALALLPRP"
     MDRPKPSRLW TIESRTGSFG AVPRPRKFDE TQVLELAREQ FWTTGFAGTR MDDIARVTGL        60
     GKGSLYGAFG DKEALFRRVF DDWCGAIVVL AEENLTGPDE GALARLEAYV RFVAANTAAD       120
     VGRRGCFQAK GTAELAASDE SVADRSATTM RALLGLLSRE ITAAQRCGDL APDADPDALA       180
     SLLLVVVRGV EAVGKAGLGA EAVTSAADTA LALLPRP                                217
//

If you have problems or comments...

PBIL Back to PBIL home page