(data stored in ACNUC7421 zone)

EMBL: CP001630.PE413

CP001630.PE413       Location/Qualifiers
FT   CDS             complement(455336..456040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0420"
FT                   /product="putative hydrolase protein"
FT                   /note="KEGG: rec:RHECIAT_CH0002869 putative hydrolase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34387"
FT                   /db_xref="GOA:C6WGS1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGS1"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0002869"
FT                   /protein_id="ACU34387.1"
FT                   /translation="MSTPTVVLVHGAFADSSSWTDVVRGLRAQGVPVVAVANPLRGLES
FT                   DARYVASVANSVTGPVVLVGHSYGGALITRAARDVAGAKALVYVAAFQPDTGESALELA
FT                   NRFPGAKLGPDTLDVLVHEGAPELSIKPGDFREVFAADLPESATTVLAATQRPVAEAAL
FT                   AGGLDGEPAWRSLPSWALVANQDNAIPAASQEFMAERAGSTTTRVDASHAVAVSRPEVV
FT                   AELVLAAVRATS"
     MSTPTVVLVH GAFADSSSWT DVVRGLRAQG VPVVAVANPL RGLESDARYV ASVANSVTGP        60
     VVLVGHSYGG ALITRAARDV AGAKALVYVA AFQPDTGESA LELANRFPGA KLGPDTLDVL       120
     VHEGAPELSI KPGDFREVFA ADLPESATTV LAATQRPVAE AALAGGLDGE PAWRSLPSWA       180
     LVANQDNAIP AASQEFMAER AGSTTTRVDA SHAVAVSRPE VVAELVLAAV RATS             234
//

If you have problems or comments...

PBIL Back to PBIL home page