(data stored in ACNUC7421 zone)

EMBL: CP001630.PE414

CP001630.PE414       Location/Qualifiers
FT   CDS             456177..456746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0421"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: smd:Smed_4442
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34388"
FT                   /db_xref="GOA:C6WGS2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGS2"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU34388.1"
FT                   /translation="MTTAPVRDEHPRERLLRTAARLFYAEGVHAVGVDRLVKQASVTRA
FT                   TFYRHFPAKDDLVAAYLAEESLRIREGMAALTDGRPPRAALVAMLAEVGDATCADGFRG
FT                   CQFLNAAAEHPDPAHPVRAVVDDHRRWFAGRLRDLAAEAGCQDPDHVARVLVLLRDGAL
FT                   SGGDLDDPALVRATLRRAVEAVVPER"
     MTTAPVRDEH PRERLLRTAA RLFYAEGVHA VGVDRLVKQA SVTRATFYRH FPAKDDLVAA        60
     YLAEESLRIR EGMAALTDGR PPRAALVAML AEVGDATCAD GFRGCQFLNA AAEHPDPAHP       120
     VRAVVDDHRR WFAGRLRDLA AEAGCQDPDH VARVLVLLRD GALSGGDLDD PALVRATLRR       180
     AVEAVVPER                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page