(data stored in ACNUC7421 zone)

EMBL: CP001630.PE415

CP001630.PE415       Location/Qualifiers
FT   CDS             complement(456953..457957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0422"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   cak:Caul_0434 alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34389"
FT                   /db_xref="GOA:C6WHT8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHT8"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ACU34389.1"
FT                   /translation="MTGTMKAVRLHEHGGPEVLRLDEVPVPEVGPGEVRVRVRAVGLNP
FT                   PDWYLREGMTKIPPELRPRLDLPLIPGTDVSGVVEEVGEGAGWAVGDEVFGMLRFPSPG
FT                   GSAYAEQVVAPATDLARKPAGVDHVQAAGAPMAGLTAWQFLIALGHEVAPPFQPRPHHP
FT                   VPLGSGTTVLVNGAAGGVGHFAVQLARWRGARVVAVASGSHGEFLRGLGADVVVDYTRE
FT                   RAEDLVDEVDLVLDAVGGEATGRFLPLVRRGGALFPVFPGPYDVAEAARREVTVSATQV
FT                   RASGAQLAELGALLGSGEVRVGVDSVFPLADAAAAHARAERGHIRGKIVLVVD"
     MTGTMKAVRL HEHGGPEVLR LDEVPVPEVG PGEVRVRVRA VGLNPPDWYL REGMTKIPPE        60
     LRPRLDLPLI PGTDVSGVVE EVGEGAGWAV GDEVFGMLRF PSPGGSAYAE QVVAPATDLA       120
     RKPAGVDHVQ AAGAPMAGLT AWQFLIALGH EVAPPFQPRP HHPVPLGSGT TVLVNGAAGG       180
     VGHFAVQLAR WRGARVVAVA SGSHGEFLRG LGADVVVDYT RERAEDLVDE VDLVLDAVGG       240
     EATGRFLPLV RRGGALFPVF PGPYDVAEAA RREVTVSATQ VRASGAQLAE LGALLGSGEV       300
     RVGVDSVFPL ADAAAAHARA ERGHIRGKIV LVVD                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page