(data stored in ACNUC7421 zone)

EMBL: CP001630.PE416

CP001630.PE416       Location/Qualifiers
FT   CDS             458084..458638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0423"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: cak:Caul_0435
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34390"
FT                   /db_xref="GOA:C6WHT9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHT9"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU34390.1"
FT                   /translation="MRADARKNRDHLLAIADAVITEQGADVSMRDLARRAEVGLATLLR
FT                   HFPTRDALLDALLRAGFDELTTLADRLEARLPPGEALKAWLREFVACAHTYRGAVTTMM
FT                   GAIEDPDSALHASCVAMRGSGARLLERAQAAGQARTDLTGPDLFALGGALIWLHDQPTS
FT                   APRADHLLDVVAAAILTPEKP"
     MRADARKNRD HLLAIADAVI TEQGADVSMR DLARRAEVGL ATLLRHFPTR DALLDALLRA        60
     GFDELTTLAD RLEARLPPGE ALKAWLREFV ACAHTYRGAV TTMMGAIEDP DSALHASCVA       120
     MRGSGARLLE RAQAAGQART DLTGPDLFAL GGALIWLHDQ PTSAPRADHL LDVVAAAILT       180
     PEKP                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page