(data stored in ACNUC7421 zone)

EMBL: CP001630.PE417

CP001630.PE417       Location/Qualifiers
FT   CDS             complement(458684..459514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0424"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /note="TIGRFAM: phosphomethylpyrimidine kinase; PFAM:
FT                   Phosphomethylpyrimidine kinase type-1; KEGG: sfu:Sfum_1692
FT                   phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34391"
FT                   /db_xref="GOA:C6WHU0"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHU0"
FT                   /inference="protein motif:TFAM:TIGR00097"
FT                   /protein_id="ACU34391.1"
FT                   /translation="MERPSVVETPKKVLTIAGSDSGGGAGLQADLRVLAACGVHGMTAV
FT                   TAVTVQNSLGVSGVVEIPAEQVAAQIRVVATDIGVDAAKTGMLASAPIIEAVAAACDEV
FT                   GIGSGGTPFVVDPVSASMHGDPLLTDAALEALRVLLFPRATLVTPNLDEVRLLTGVDVR
FT                   TREEQREVAKVLHGMGPQWVLVKGGHMRGDPECLDLLYDGREFHEYVGPRYDVLHTHGS
FT                   GDTLASSICSRLARGVGVVDAVRFGKDFVVRSVLAAYPLGAGVGPVSPLWRLAE"
     MERPSVVETP KKVLTIAGSD SGGGAGLQAD LRVLAACGVH GMTAVTAVTV QNSLGVSGVV        60
     EIPAEQVAAQ IRVVATDIGV DAAKTGMLAS APIIEAVAAA CDEVGIGSGG TPFVVDPVSA       120
     SMHGDPLLTD AALEALRVLL FPRATLVTPN LDEVRLLTGV DVRTREEQRE VAKVLHGMGP       180
     QWVLVKGGHM RGDPECLDLL YDGREFHEYV GPRYDVLHTH GSGDTLASSI CSRLARGVGV       240
     VDAVRFGKDF VVRSVLAAYP LGAGVGPVSP LWRLAE                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page