(data stored in ACNUC7421 zone)

EMBL: CP001630.PE418

CP001630.PE418       Location/Qualifiers
FT   CDS             complement(459516..461159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0425"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /note="TIGRFAM: thiamine biosynthesis protein ThiC; PFAM:
FT                   thiamine biosynthesis protein ThiC; KEGG: bsu:BSU08790
FT                   thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34392"
FT                   /db_xref="GOA:C6WHU1"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHU1"
FT                   /inference="protein motif:TFAM:TIGR00190"
FT                   /protein_id="ACU34392.1"
FT                   /translation="MTALGDGSVRPSVTTGPIRGSRKVHRDAEDGVRVPFRRVELTDGD
FT                   HFDLYDTSGPYTAGDVDVREGLEKIRAGWISAREPVNGAATQLAWARAGVITPEMRFAA
FT                   LRESLAPEFVRDEVAAGRAVIPANRNHPESEPMVIGKGFLVKVNANIGNSAVTSSVEEE
FT                   VEKMVWATRWGADTVMDLSTGKRIHETREWIIRNSPVPVGTVPIYQALEKVGGDPAALS
FT                   WEVYRDTVVEQAEQGVDYMTVHAGVLLRYVPLTARRVTGIVSRGGSIMAAWCLAHHEES
FT                   FLYTRFAELCEILRQYDVTFSLGDGLRPGSIADANDEAQFAELRTLGELARVARAHDVQ
FT                   VMIEGPGHVPLHKIAENVRLEQEWCDGAPFYTLGPLATDVAPAYDHITSAIGAAQIGAL
FT                   GTAMLCYVTPKEHLGLPDRDDVKTGVITYKIAAHAADLAKGHPGAQAWDDALSRARFEF
FT                   RWEDQFNLSLDPDTAREFHDRTLPAEPAKTAHFCSMCGPKFCSMRITQDVRRYAEERGL
FT                   STVEAIEAGMAEKAHEFDDRGGKVYLPVVD"
     MTALGDGSVR PSVTTGPIRG SRKVHRDAED GVRVPFRRVE LTDGDHFDLY DTSGPYTAGD        60
     VDVREGLEKI RAGWISAREP VNGAATQLAW ARAGVITPEM RFAALRESLA PEFVRDEVAA       120
     GRAVIPANRN HPESEPMVIG KGFLVKVNAN IGNSAVTSSV EEEVEKMVWA TRWGADTVMD       180
     LSTGKRIHET REWIIRNSPV PVGTVPIYQA LEKVGGDPAA LSWEVYRDTV VEQAEQGVDY       240
     MTVHAGVLLR YVPLTARRVT GIVSRGGSIM AAWCLAHHEE SFLYTRFAEL CEILRQYDVT       300
     FSLGDGLRPG SIADANDEAQ FAELRTLGEL ARVARAHDVQ VMIEGPGHVP LHKIAENVRL       360
     EQEWCDGAPF YTLGPLATDV APAYDHITSA IGAAQIGALG TAMLCYVTPK EHLGLPDRDD       420
     VKTGVITYKI AAHAADLAKG HPGAQAWDDA LSRARFEFRW EDQFNLSLDP DTAREFHDRT       480
     LPAEPAKTAH FCSMCGPKFC SMRITQDVRR YAEERGLSTV EAIEAGMAEK AHEFDDRGGK       540
     VYLPVVD                                                                 547
//

If you have problems or comments...

PBIL Back to PBIL home page