(data stored in ACNUC7421 zone)

EMBL: CP001630.PE419

CP001630.PE419       Location/Qualifiers
FT   CDS             461485..462102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0426"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34393"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHU2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34393.1"
FT                   /translation="MWLLDWQELLSAEQLAEGGSGERELAERVLADPVGRHAWTCVDWA
FT                   MTLVTCSQCGAEPTAGPWDCVRCAVTESARWQWDHTATPGAITPAEHALRAARAALRAP
FT                   HRRRSPVVDAWRLLLPFLVAGHGATSADVSRLRAQVIGGSYAELAACGSAVELTGFVEL
FT                   PWRRTSPTGDHQPQPQPHRRRPRQQLEAAPDAGAPQVAPDPV"
     MWLLDWQELL SAEQLAEGGS GERELAERVL ADPVGRHAWT CVDWAMTLVT CSQCGAEPTA        60
     GPWDCVRCAV TESARWQWDH TATPGAITPA EHALRAARAA LRAPHRRRSP VVDAWRLLLP       120
     FLVAGHGATS ADVSRLRAQV IGGSYAELAA CGSAVELTGF VELPWRRTSP TGDHQPQPQP       180
     HRRRPRQQLE AAPDAGAPQV APDPV                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page