(data stored in ACNUC7421 zone)

EMBL: CP001630.PE42

CP001630.PE42        Location/Qualifiers
FT   CDS             complement(45733..46482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0042"
FT                   /product="nuclear export factor GLE1"
FT                   /note="PFAM: nuclear export factor GLE1; KEGG: sme:SMa1200
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34016"
FT                   /db_xref="GOA:C6WCJ5"
FT                   /db_xref="InterPro:IPR012533"
FT                   /db_xref="InterPro:IPR038507"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCJ5"
FT                   /inference="protein motif:PFAM:PF07987"
FT                   /protein_id="ACU34016.1"
FT                   /translation="MSTTRTGLRPLVRAGALLTTAGFLALGTAGTASAHVSASTTAPAT
FT                   QGGYAKVIFRVPNERPDSGTVKLEVTLPAEYPLASVSTKPLPGWQVEAVKATLDKPVTS
FT                   HGREVTEAVRTVVWTADAGVQIAPGQFNEFEVSVGPLPDTTEQLVMPAKQTYASGEVVD
FT                   WSAPPADEEPEHPAPVLKLVKPAEGADSHGNAPAGSGDSHSETAASTTTDDTARWLGGA
FT                   GLAVGALGLGLGAGAVLRTRRSGKPSA"
     MSTTRTGLRP LVRAGALLTT AGFLALGTAG TASAHVSAST TAPATQGGYA KVIFRVPNER        60
     PDSGTVKLEV TLPAEYPLAS VSTKPLPGWQ VEAVKATLDK PVTSHGREVT EAVRTVVWTA       120
     DAGVQIAPGQ FNEFEVSVGP LPDTTEQLVM PAKQTYASGE VVDWSAPPAD EEPEHPAPVL       180
     KLVKPAEGAD SHGNAPAGSG DSHSETAAST TTDDTARWLG GAGLAVGALG LGLGAGAVLR       240
     TRRSGKPSA                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page