(data stored in ACNUC7421 zone)

EMBL: CP001630.PE420

CP001630.PE420       Location/Qualifiers
FT   CDS             complement(462297..462884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0427"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: pmr:PMI2825 peptide deformylase; TIGRFAM:
FT                   peptide deformylase; PFAM: formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34394"
FT                   /db_xref="GOA:C6WHU3"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHU3"
FT                   /inference="protein motif:TFAM:TIGR00079"
FT                   /protein_id="ACU34394.1"
FT                   /translation="MAVHPIRIAGDPVLHNPTRPVDEHDDELRALIADMYETMAAANGV
FT                   GLAANQIGVDLRLFVYDCPDDEGVRRRGEVVNPVLQTSDVPLGMPDPDDDYEGCLSAPG
FT                   ESYPTGRASWAKVTGTDGNGDPVEVEGTGFFARCLQHETDHLDGYLYLDRLVGRHKRAS
FT                   KKMIKANGWGVPGLSWDPATSEDPFADDEDED"
     MAVHPIRIAG DPVLHNPTRP VDEHDDELRA LIADMYETMA AANGVGLAAN QIGVDLRLFV        60
     YDCPDDEGVR RRGEVVNPVL QTSDVPLGMP DPDDDYEGCL SAPGESYPTG RASWAKVTGT       120
     DGNGDPVEVE GTGFFARCLQ HETDHLDGYL YLDRLVGRHK RASKKMIKAN GWGVPGLSWD       180
     PATSEDPFAD DEDED                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page