(data stored in ACNUC7421 zone)

EMBL: CP001630.PE422

CP001630.PE422       Location/Qualifiers
FT   CDS             463329..463991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0429"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34396"
FT                   /db_xref="GOA:C6WHU5"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHU5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34396.1"
FT                   /translation="MSNPESSGSAQPARAAGYALLGLAGVALVLGVVTLFTGSDDDPQA
FT                   QQQQPAPSASAPAEPGPSSEPPAGEPSASEPPASESAGAPTTTTGQPPATTTEQQPQPQ
FT                   PPAQQPGDQSQGTPATRPSVRVYNNSNISGLAARASDDIGKSGWAVQATGNYPDGIIET
FT                   TTVYYRAGTAEEDAAKQLAQSIRARVMPRFDGIKDAHDGVIVIVTNDYQGPGGKAGS"
     MSNPESSGSA QPARAAGYAL LGLAGVALVL GVVTLFTGSD DDPQAQQQQP APSASAPAEP        60
     GPSSEPPAGE PSASEPPASE SAGAPTTTTG QPPATTTEQQ PQPQPPAQQP GDQSQGTPAT       120
     RPSVRVYNNS NISGLAARAS DDIGKSGWAV QATGNYPDGI IETTTVYYRA GTAEEDAAKQ       180
     LAQSIRARVM PRFDGIKDAH DGVIVIVTND YQGPGGKAGS                             220
//

If you have problems or comments...

PBIL Back to PBIL home page