(data stored in ACNUC7421 zone)

EMBL: CP001630.PE424

CP001630.PE424       Location/Qualifiers
FT   CDS             464849..465946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0431"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   gme:Gmet_2577 NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34398"
FT                   /db_xref="GOA:C6WHU7"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHU7"
FT                   /inference="protein motif:PFAM:PF00724"
FT                   /protein_id="ACU34398.1"
FT                   /translation="MSTLFSTLTLRSLDIPNRVWMSPMCTYSAAPSGPEAGVPTDFHLT
FT                   HLASRAAGGAGLVMAEATGVRADGRISPWDLGLWNDAQQEAFARITAAISAHGAVPAIQ
FT                   LAHAGRKASTNKPWLGGGSVADTEHGWQPVGPSPAPFHGLPVPRELTTGEIAALVEDFA
FT                   ASARRALAAGFKVVEVHGAHGYLINSFLSPISNQRTDEYGGTTENRMRFALEVVDAVRA
FT                   VWPEDLPVLFRTSATDWTAEQGGVGWAEDDTVLLAKELQQRGVDLLDVSTGGMAHDAVI
FT                   PVESHYQVRFAAKVREATGLPTGAVGLITEPARAEEVVATGQADAVLLGRELLRDPYWA
FT                   HHAAQELGVDSNWPEQYGYAVRPRR"
     MSTLFSTLTL RSLDIPNRVW MSPMCTYSAA PSGPEAGVPT DFHLTHLASR AAGGAGLVMA        60
     EATGVRADGR ISPWDLGLWN DAQQEAFARI TAAISAHGAV PAIQLAHAGR KASTNKPWLG       120
     GGSVADTEHG WQPVGPSPAP FHGLPVPREL TTGEIAALVE DFAASARRAL AAGFKVVEVH       180
     GAHGYLINSF LSPISNQRTD EYGGTTENRM RFALEVVDAV RAVWPEDLPV LFRTSATDWT       240
     AEQGGVGWAE DDTVLLAKEL QQRGVDLLDV STGGMAHDAV IPVESHYQVR FAAKVREATG       300
     LPTGAVGLIT EPARAEEVVA TGQADAVLLG RELLRDPYWA HHAAQELGVD SNWPEQYGYA       360
     VRPRR                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page