(data stored in ACNUC7421 zone)

EMBL: CP001630.PE425

CP001630.PE425       Location/Qualifiers
FT   CDS             466404..468608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0432"
FT                   /product="Microtubule-severing ATPase"
FT                   /EC_number="3.6.4.3"
FT                   /note="KEGG: mrd:Mrad2831_5798 AAA family ATPase, CDC48
FT                   subfamily protein; PFAM: AAA ATPase central domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34399"
FT                   /db_xref="GOA:C6WHU8"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHU8"
FT                   /inference="protein motif:PRIAM:3.6.4.3"
FT                   /protein_id="ACU34399.1"
FT                   /translation="MITLTARLSPSALDTRRGVVRMHREVLDALGLRQWDAVRLTGARV
FT                   SAALAAAAPDGSPVGVVLVDDITLSNLGVTEGAELVVTPVEVSAARTITVAGSRLASTA
FT                   LTPETLRMALTGKVLTVGDAVSLLPQDLAPPPGADVSATRRKLSAAIGTTWTNELLTIT
FT                   SADPGGVVAVRPSTLVAWRDATAPAPAQAAPPAVDAGITPVTPPPPPAEALPVADLVGQ
FT                   QDAARRLAEWLDLVLTQPELLTRLGAAPRLAALVSGPEGVGKATLVRAVAHAAGTRVVE
FT                   VSAPAIAVLEANATARALADAITQAQSQPGSPAVLVLTDVEALLPAATPPPVATVVLDA
FT                   LRAALAATPLVVTSASPELIDPRLRVPDLVDRELVLPLPDGATRRELLRALLREVPLEP
FT                   DVDLAEVADRTPGFVAADLVAVRREAAVRSALRQRQEAEPRVAQEDLLGSLDTVRPISM
FT                   STSDTLRTGGLTLDDVGDMAEVKQALTEAALWPLQYPDSFARLGVEPPRGLLLYGPPGC
FT                   GKTFLVRALAGTGKLNVLSVKGAELMDKFVGESERAVRELFRRAAEAAPALVFLDEVDA
FT                   LAPRRGQSSDSGVADRVVAALLTELDGVEPLRDVIVLGATNRPELVDPALLRPGRLERL
FT                   VYVPPPDAEARVEILRSASRNTPLAEDVELTALADDLDGYSAADCAALIREAALTAMRE
FT                   SLSATAVTAEHLAKARGVVRPSLDPAQLASLAAYAESRKA"
     MITLTARLSP SALDTRRGVV RMHREVLDAL GLRQWDAVRL TGARVSAALA AAAPDGSPVG        60
     VVLVDDITLS NLGVTEGAEL VVTPVEVSAA RTITVAGSRL ASTALTPETL RMALTGKVLT       120
     VGDAVSLLPQ DLAPPPGADV SATRRKLSAA IGTTWTNELL TITSADPGGV VAVRPSTLVA       180
     WRDATAPAPA QAAPPAVDAG ITPVTPPPPP AEALPVADLV GQQDAARRLA EWLDLVLTQP       240
     ELLTRLGAAP RLAALVSGPE GVGKATLVRA VAHAAGTRVV EVSAPAIAVL EANATARALA       300
     DAITQAQSQP GSPAVLVLTD VEALLPAATP PPVATVVLDA LRAALAATPL VVTSASPELI       360
     DPRLRVPDLV DRELVLPLPD GATRRELLRA LLREVPLEPD VDLAEVADRT PGFVAADLVA       420
     VRREAAVRSA LRQRQEAEPR VAQEDLLGSL DTVRPISMST SDTLRTGGLT LDDVGDMAEV       480
     KQALTEAALW PLQYPDSFAR LGVEPPRGLL LYGPPGCGKT FLVRALAGTG KLNVLSVKGA       540
     ELMDKFVGES ERAVRELFRR AAEAAPALVF LDEVDALAPR RGQSSDSGVA DRVVAALLTE       600
     LDGVEPLRDV IVLGATNRPE LVDPALLRPG RLERLVYVPP PDAEARVEIL RSASRNTPLA       660
     EDVELTALAD DLDGYSAADC AALIREAALT AMRESLSATA VTAEHLAKAR GVVRPSLDPA       720
     QLASLAAYAE SRKA                                                         734
//

If you have problems or comments...

PBIL Back to PBIL home page