(data stored in ACNUC7421 zone)

EMBL: CP001630.PE426

CP001630.PE426       Location/Qualifiers
FT   CDS             468892..469416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0433"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 4 domain protein; Sigma-70
FT                   region 4 type 2; sigma-70 region 2 domain protein; KEGG:
FT                   scl:sce7901 ECF family RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34400"
FT                   /db_xref="GOA:C6WHU9"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHU9"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACU34400.1"
FT                   /translation="MDRQDFTRIARERAVPWRRVAYLICGDWGRAEDLVQAALLRMYKH
FT                   WHRIEPRGLEAYARKVISRLALDEAKRASRRKEVLGEVPDRPAAQFDEEVDGAPEVRAA
FT                   LKAMPPRQRAVIVLRFYADLDVAATAKALGITQGTVKSQCSRGLDSLRAALGPHHAALA
FT                   TRTPERTGGSR"
     MDRQDFTRIA RERAVPWRRV AYLICGDWGR AEDLVQAALL RMYKHWHRIE PRGLEAYARK        60
     VISRLALDEA KRASRRKEVL GEVPDRPAAQ FDEEVDGAPE VRAALKAMPP RQRAVIVLRF       120
     YADLDVAATA KALGITQGTV KSQCSRGLDS LRAALGPHHA ALATRTPERT GGSR             174
//

If you have problems or comments...

PBIL Back to PBIL home page