(data stored in ACNUC7421 zone)

EMBL: CP001630.PE427

CP001630.PE427       Location/Qualifiers
FT   CDS             469413..470174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0434"
FT                   /product="DnaJ domain protein"
FT                   /note="KEGG: mxa:MXAN_3349 DnaJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34401"
FT                   /db_xref="GOA:C6WHV0"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHV0"
FT                   /inference="similar to AA sequence:KEGG:MXAN_3349"
FT                   /protein_id="ACU34401.1"
FT                   /translation="MNVRKDFFDHAIGRGEPPVELDFEAIEREGADALRRRRRVVPALA
FT                   MAGVAAVAGGIMALATGAGSTGGLVEQGSGGGDPIPATPAPPSRHSQDAGPSSAATDPS
FT                   PAGSTPPDTGSAPSSTAAGSPQVHRADAWTLEPTAVATADRFPICFSKASMAGYGQAGG
FT                   PETVLVRPVPTSSVAPTPDGVDRFDIALDVCRQFWTDNTRGWRAPDAPVPALVRCVLVL
FT                   PQSPEHGSIGVYPGDEGTCRELGFPVATPAK"
     MNVRKDFFDH AIGRGEPPVE LDFEAIEREG ADALRRRRRV VPALAMAGVA AVAGGIMALA        60
     TGAGSTGGLV EQGSGGGDPI PATPAPPSRH SQDAGPSSAA TDPSPAGSTP PDTGSAPSST       120
     AAGSPQVHRA DAWTLEPTAV ATADRFPICF SKASMAGYGQ AGGPETVLVR PVPTSSVAPT       180
     PDGVDRFDIA LDVCRQFWTD NTRGWRAPDA PVPALVRCVL VLPQSPEHGS IGVYPGDEGT       240
     CRELGFPVAT PAK                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page