(data stored in ACNUC7421 zone)

EMBL: CP001630.PE428

CP001630.PE428       Location/Qualifiers
FT   CDS             complement(470346..471323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0435"
FT                   /product="CDP-diacylglycerol/serineO-phosphatidyltransfera
FT                   se"
FT                   /EC_number="2.7.8.8"
FT                   /note="KEGG: mag:amb0603 phosphatidylserine synthase;
FT                   TIGRFAM: CDP-diacylglycerol/serine O-
FT                   phosphatidyltransferase; PFAM: CDP-alcohol
FT                   phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34402"
FT                   /db_xref="GOA:C6WHV1"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="InterPro:IPR012616"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHV1"
FT                   /inference="protein motif:TFAM:TIGR00473"
FT                   /protein_id="ACU34402.1"
FT                   /translation="MASTAPGVRLLPNAITVLAMCAGLSAVHFAIRGMYGAAIASIAAA
FT                   ALFDGLDGRLARMLDATSKMGAELDSLADSISFGVAPAMVLYVWKFDPDRFGWVVSLVF
FT                   AVCMVLRLARFNTLLDVEQPPYAKEFFVGVPAPIGGLLLLLPLTLDEQLGRSGWWSSTP
FT                   VVAVWTVTVALLLVSRIPTLSIKTIKVPQRLVAPLLVVVALVAAALITFPLAVLVVIEV
FT                   VYLAHLPYAVRRYRWLAKHPEAWEVPPADRRAIRRAHGVAARRLGLRQPMRNRVAGAAR
FT                   RAVRRPRRVDADDVPGPVGSDGAESRRENGGGRRAWRQLGLRRK"
     MASTAPGVRL LPNAITVLAM CAGLSAVHFA IRGMYGAAIA SIAAAALFDG LDGRLARMLD        60
     ATSKMGAELD SLADSISFGV APAMVLYVWK FDPDRFGWVV SLVFAVCMVL RLARFNTLLD       120
     VEQPPYAKEF FVGVPAPIGG LLLLLPLTLD EQLGRSGWWS STPVVAVWTV TVALLLVSRI       180
     PTLSIKTIKV PQRLVAPLLV VVALVAAALI TFPLAVLVVI EVVYLAHLPY AVRRYRWLAK       240
     HPEAWEVPPA DRRAIRRAHG VAARRLGLRQ PMRNRVAGAA RRAVRRPRRV DADDVPGPVG       300
     SDGAESRREN GGGRRAWRQL GLRRK                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page