(data stored in ACNUC7421 zone)

EMBL: CP001630.PE429

CP001630.PE429       Location/Qualifiers
FT   CDS             complement(471327..472040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0436"
FT                   /product="phosphatidylserine decarboxylase related protein"
FT                   /EC_number="4.1.1.65"
FT                   /note="KEGG: rce:RC1_1432 phosphatidylserine decarboxylase-
FT                   like protein, putative; TIGRFAM: phosphatidylserine
FT                   decarboxylase related protein; PFAM: phosphatidylserine
FT                   decarboxylase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34403"
FT                   /db_xref="GOA:C6WHV2"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033175"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHV2"
FT                   /inference="protein motif:TFAM:TIGR00164"
FT                   /protein_id="ACU34403.1"
FT                   /translation="MTVDRDKHNSGAVSHFIELAKGIVPPMHPAGRPFVAGAAAATLLL
FT                   RRISKPAGVVGALVTAWVAWFFREPKRTTPTRAGLAIAPADGTVSHVVEALPPAELGLG
FT                   SEPMTRISVFLSVFDVHVQRVPVTGVVRQVSYHAGKFLSADLDKASEENERNTVWLTSE
FT                   EGHEIVVVQIAGLVARRIVCEVSEGDAVAAGSTYGLIRFGSRVDLYVPRGSRVLVEAGQ
FT                   RTIGGETVLAELPGN"
     MTVDRDKHNS GAVSHFIELA KGIVPPMHPA GRPFVAGAAA ATLLLRRISK PAGVVGALVT        60
     AWVAWFFREP KRTTPTRAGL AIAPADGTVS HVVEALPPAE LGLGSEPMTR ISVFLSVFDV       120
     HVQRVPVTGV VRQVSYHAGK FLSADLDKAS EENERNTVWL TSEEGHEIVV VQIAGLVARR       180
     IVCEVSEGDA VAAGSTYGLI RFGSRVDLYV PRGSRVLVEA GQRTIGGETV LAELPGN          237
//

If you have problems or comments...

PBIL Back to PBIL home page