(data stored in ACNUC7421 zone)

EMBL: CP001630.PE43

CP001630.PE43        Location/Qualifiers
FT   CDS             complement(46508..47065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0043"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0776 putative membrane glycoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34017"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCJ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34017.1"
FT                   /translation="MATRPGVTSRAARGSLVAVTSASLGLAAHGAAGGEAVELTPVLPL
FT                   LLLTASAGTALAERRRTPWAVVGALVSAQAGQHALLSLAAHQHHGPGLGLDPLAMTAAH
FT                   VVAALLTGLLLARADAVLLALAGAAARLLPVLREPRPASRPAALPAPEGHPQPTPVRIT
FT                   LRRVNARRGPPALPIAPHPGPR"
     MATRPGVTSR AARGSLVAVT SASLGLAAHG AAGGEAVELT PVLPLLLLTA SAGTALAERR        60
     RTPWAVVGAL VSAQAGQHAL LSLAAHQHHG PGLGLDPLAM TAAHVVAALL TGLLLARADA       120
     VLLALAGAAA RLLPVLREPR PASRPAALPA PEGHPQPTPV RITLRRVNAR RGPPALPIAP       180
     HPGPR                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page