(data stored in ACNUC7421 zone)

EMBL: CP001630.PE430

CP001630.PE430       Location/Qualifiers
FT   CDS             complement(472257..473768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0437"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: sfu:Sfum_1032
FT                   peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34404"
FT                   /db_xref="GOA:C6WHV3"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHV3"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ACU34404.1"
FT                   /translation="MRAVLAVGLLIGFFVLFTALTVGLCALTVYGFATGREFNAIKIAL
FT                   IAVPLVLILISALYKALKARGEVEGAPLTREAQPGLWAVVDELAAVAGTRGPDEIRLVG
FT                   AVNAAVSEQAPMLGLRAGRRTLLIGLPLLAGLTASELRSVLAHELGHYGGGHTKLSALT
FT                   YRAKEALVHVVDGLDDTFLQRPFAWYAKLYARVAASVNRRQELDADTASVTAAGREAAQ
FT                   SALRKLPVLGAAWNGYQAQFLSLGAQAELTPPVMAGFHAYLSEPERRGRMDEARAELLA
FT                   REPESVFDSHPPIRERVGRMATLPSPEVERDDRPAWTLLSGATADLERSIMVGGGFGPT
FT                   ADWDEVVSVVAREHGERRAGLLAVAGARAGLPGEVSLDDALAALASTGQRDALLGHLLS
FT                   AELLGGEVPEEQRAQVLAGLLGAVLEHELVAAGVGAYEADWDKRWVVRLEDGRAVDGPP
FT                   LFAEVLGGPERAAEAWKRAADVLGTRRARVTRVQRIAEDLVVPTA"
     MRAVLAVGLL IGFFVLFTAL TVGLCALTVY GFATGREFNA IKIALIAVPL VLILISALYK        60
     ALKARGEVEG APLTREAQPG LWAVVDELAA VAGTRGPDEI RLVGAVNAAV SEQAPMLGLR       120
     AGRRTLLIGL PLLAGLTASE LRSVLAHELG HYGGGHTKLS ALTYRAKEAL VHVVDGLDDT       180
     FLQRPFAWYA KLYARVAASV NRRQELDADT ASVTAAGREA AQSALRKLPV LGAAWNGYQA       240
     QFLSLGAQAE LTPPVMAGFH AYLSEPERRG RMDEARAELL AREPESVFDS HPPIRERVGR       300
     MATLPSPEVE RDDRPAWTLL SGATADLERS IMVGGGFGPT ADWDEVVSVV AREHGERRAG       360
     LLAVAGARAG LPGEVSLDDA LAALASTGQR DALLGHLLSA ELLGGEVPEE QRAQVLAGLL       420
     GAVLEHELVA AGVGAYEADW DKRWVVRLED GRAVDGPPLF AEVLGGPERA AEAWKRAADV       480
     LGTRRARVTR VQRIAEDLVV PTA                                               503
//

If you have problems or comments...

PBIL Back to PBIL home page