(data stored in ACNUC7421 zone)

EMBL: CP001630.PE431

CP001630.PE431       Location/Qualifiers
FT   CDS             complement(473915..475120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0438"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; PFAM: MoeA domain protein domain I and II; MoeA
FT                   domain protein domain IV; molybdopterin binding domain;
FT                   KEGG: afw:Anae109_1445 molybdenum cofactor synthesis
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34405"
FT                   /db_xref="GOA:C6WHV4"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHV4"
FT                   /inference="protein motif:TFAM:TIGR00177"
FT                   /protein_id="ACU34405.1"
FT                   /translation="MDGVSNALTGVAAHKARIADLIGVAPVVELPLADCLGLVLASDAV
FT                   APVALPPFDNSAMDGYAVRVADLAELPVVLPVPEDIPAGRTDVVPLEPGTAHRIMTGAP
FT                   VPPGADAVVQVEWTDAGVRSVRIDRGVRLGQNVRWAEDDVKVGEVALRAGRVLGAAQLG
FT                   LVSALGIPALPVRRRLRVLVLSTGSELVAPGEPLLPGQIYESNGLMLAAAVREAGGEAE
FT                   QLRFVPDDVDRFRAVVEERIGGFDLLLTSGGVSAGAYEVVKDALTGRGVEFTKVAMQPG
FT                   GPQGSGRYLGVPVATLPGNPVSAQVSFEVFVRPALRAAMGFVDVERPTAVARLRGSISS
FT                   PSGRTQFRRGAYDAGSGQVVTPVGGPGSHLLSSLALSNCLIEVPAEVDELADGDEVLVR
FT                   LL"
     MDGVSNALTG VAAHKARIAD LIGVAPVVEL PLADCLGLVL ASDAVAPVAL PPFDNSAMDG        60
     YAVRVADLAE LPVVLPVPED IPAGRTDVVP LEPGTAHRIM TGAPVPPGAD AVVQVEWTDA       120
     GVRSVRIDRG VRLGQNVRWA EDDVKVGEVA LRAGRVLGAA QLGLVSALGI PALPVRRRLR       180
     VLVLSTGSEL VAPGEPLLPG QIYESNGLML AAAVREAGGE AEQLRFVPDD VDRFRAVVEE       240
     RIGGFDLLLT SGGVSAGAYE VVKDALTGRG VEFTKVAMQP GGPQGSGRYL GVPVATLPGN       300
     PVSAQVSFEV FVRPALRAAM GFVDVERPTA VARLRGSISS PSGRTQFRRG AYDAGSGQVV       360
     TPVGGPGSHL LSSLALSNCL IEVPAEVDEL ADGDEVLVRL L                           401
//

If you have problems or comments...

PBIL Back to PBIL home page