(data stored in ACNUC7421 zone)

EMBL: CP001630.PE432

CP001630.PE432       Location/Qualifiers
FT   CDS             475190..475798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0439"
FT                   /product="protein of unknown function DUF124"
FT                   /note="PFAM: protein of unknown function DUF124; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34406"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHV5"
FT                   /inference="protein motif:PFAM:PF01987"
FT                   /protein_id="ACU34406.1"
FT                   /translation="MQVRTRHTPGYGVARLLLAPAEPVLVERGSVLGTSYGVGFDTRAK
FT                   GKGVRAALCTAGPEGGWVDVAPGVPGDLHVVDLDGKSGWCFAGDAWLACAGTVGLDPAA
FT                   PPLRALHGGDAGFLNYAFGTGPLVLACAGAVDVVTLEPGELVTLHSGHVLAFADTVQCR
FT                   LRAVSPDLPQSVRDGEGLALDFAGPGLVLTRTRKPRRRS"
     MQVRTRHTPG YGVARLLLAP AEPVLVERGS VLGTSYGVGF DTRAKGKGVR AALCTAGPEG        60
     GWVDVAPGVP GDLHVVDLDG KSGWCFAGDA WLACAGTVGL DPAAPPLRAL HGGDAGFLNY       120
     AFGTGPLVLA CAGAVDVVTL EPGELVTLHS GHVLAFADTV QCRLRAVSPD LPQSVRDGEG       180
     LALDFAGPGL VLTRTRKPRR RS                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page