(data stored in ACNUC7421 zone)

EMBL: CP001630.PE434

CP001630.PE434       Location/Qualifiers
FT   CDS             476271..477605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0441"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; protein of unknown function RIO1;
FT                   SMART: serine/threonine protein kinase; tyrosine protein
FT                   kinase; KEGG: ade:Adeh_1074 serine/threonine protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34408"
FT                   /db_xref="GOA:C6WHV7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHV7"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACU34408.1"
FT                   /translation="MSEDLSGRRLGHYRIDGVLGRGGMSVTYKATDVRLGRKVALKVIG
FT                   EHLTADAEFRERFVDEARNTSAIDHANIVPLYDFDEVDGLLYIAMRLVDGQDLATHIKD
FT                   GPLAPSRALVLLEQVAEALDMLHGKGLVHLDVKPANVLVTTKEATREHVYLADFGLTRR
FT                   GATGHRTRTGDFLGSPTYAAPEHLRGEPLDGRTDQYALACMVFACLTGRPPFQGGVQDV
FT                   IQGHLGSEIPPITSLVSLPPAVDDVLRKGTSKDPAQRFATCHEFITAVTAALGPAAQQT
FT                   TPPRPAGAPAPQQHAGQQHAGPASGGFPAQQGGYPQRPGYQQHQHQQQYPPSEPIRLRP
FT                   PTPVGVSAFSDTKQPRPAWFVPALAGAIAVVVIVILVLVLKPEDEPTRPPSSLPASSGP
FT                   ASPGQALASAPLPGPVLPASALPGAAGVPSAVIGDAQSPSVPPSA"
     MSEDLSGRRL GHYRIDGVLG RGGMSVTYKA TDVRLGRKVA LKVIGEHLTA DAEFRERFVD        60
     EARNTSAIDH ANIVPLYDFD EVDGLLYIAM RLVDGQDLAT HIKDGPLAPS RALVLLEQVA       120
     EALDMLHGKG LVHLDVKPAN VLVTTKEATR EHVYLADFGL TRRGATGHRT RTGDFLGSPT       180
     YAAPEHLRGE PLDGRTDQYA LACMVFACLT GRPPFQGGVQ DVIQGHLGSE IPPITSLVSL       240
     PPAVDDVLRK GTSKDPAQRF ATCHEFITAV TAALGPAAQQ TTPPRPAGAP APQQHAGQQH       300
     AGPASGGFPA QQGGYPQRPG YQQHQHQQQY PPSEPIRLRP PTPVGVSAFS DTKQPRPAWF       360
     VPALAGAIAV VVIVILVLVL KPEDEPTRPP SSLPASSGPA SPGQALASAP LPGPVLPASA       420
     LPGAAGVPSA VIGDAQSPSV PPSA                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page