(data stored in ACNUC7421 zone)

EMBL: CP001630.PE435

CP001630.PE435       Location/Qualifiers
FT   CDS             477845..479467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0442"
FT                   /product="chaperonin GroEL"
FT                   /note="TIGRFAM: chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1; KEGG: bcb:BCB4264_A0298 chaperonin GroL"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34409"
FT                   /db_xref="GOA:C6WHV8"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHV8"
FT                   /inference="protein motif:TFAM:TIGR02348"
FT                   /protein_id="ACU34409.1"
FT                   /translation="MAKMIAFDEDARRGLERGMNILADAVKVTLGPKGRNVVLEKKWGA
FT                   PTITNDGVSIAKEIELEDPWEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVREGLR
FT                   NVAAGANPLGLKRGIEKAVEAVTEQLLKTAKEVETKEQIAATASISAGDSTIGELIAEA
FT                   MDKVGKEGVITVEESNALGLELELTEGMRFDKGYISGYFVSDPERQEAVLEDPYILLYG
FT                   SKIASVKDLLPLLEKVMQSGKPLLIISEDVEGEALATLVVNKIRGTFKSVAVKAPGFGD
FT                   RRKAILQDIAILTGGQVITEDVGLKLDTADLSLLGKARKVVVTKDETTVVEGSGDAEQI
FT                   QGRVNQIRAEIEKSDSDYDREKLQERLAKLAGGVAVIKAGAATEVELKERKHRIEDAVR
FT                   NAKAAVEEGIVAGGGVALLQAAEAAFAGLKLEGDEATGANIVKVAVEAPLKQIAVNAGL
FT                   EGGVVVEKVKGLPVGHGLNAATGVYEDLLAAGVPDPTKVTRSALQNAASIAALFLTTEA
FT                   VVADKPEKAGAAPAMPDAGGMDF"
     MAKMIAFDED ARRGLERGMN ILADAVKVTL GPKGRNVVLE KKWGAPTITN DGVSIAKEIE        60
     LEDPWEKIGA ELVKEVAKKT DDVAGDGTTT ATVLAQALVR EGLRNVAAGA NPLGLKRGIE       120
     KAVEAVTEQL LKTAKEVETK EQIAATASIS AGDSTIGELI AEAMDKVGKE GVITVEESNA       180
     LGLELELTEG MRFDKGYISG YFVSDPERQE AVLEDPYILL YGSKIASVKD LLPLLEKVMQ       240
     SGKPLLIISE DVEGEALATL VVNKIRGTFK SVAVKAPGFG DRRKAILQDI AILTGGQVIT       300
     EDVGLKLDTA DLSLLGKARK VVVTKDETTV VEGSGDAEQI QGRVNQIRAE IEKSDSDYDR       360
     EKLQERLAKL AGGVAVIKAG AATEVELKER KHRIEDAVRN AKAAVEEGIV AGGGVALLQA       420
     AEAAFAGLKL EGDEATGANI VKVAVEAPLK QIAVNAGLEG GVVVEKVKGL PVGHGLNAAT       480
     GVYEDLLAAG VPDPTKVTRS ALQNAASIAA LFLTTEAVVA DKPEKAGAAP AMPDAGGMDF       540
//

If you have problems or comments...

PBIL Back to PBIL home page