(data stored in ACNUC7421 zone)

EMBL: CP001630.PE437

CP001630.PE437       Location/Qualifiers
FT   CDS             complement(480441..481046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0444"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; KEGG:
FT                   sus:Acid_3132 ECF subfamily RNA polymerase sigma-24 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34411"
FT                   /db_xref="GOA:C6WHW0"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHW0"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACU34411.1"
FT                   /translation="MGELRMTGERPPWEGLDGTDRHEVCVIAARSGDRRALDVLIHDLT
FT                   PLVWHVARGHGLDRSTAEDVVQTVWLALLRNLGRITQPRALAGWLVVATRREAQRTWTP
FT                   SRRESSLSDEMAEQQESHIGLPEDAALVDDRDQRLWRAFGKLSQRCQELLRLTVLAGRA
FT                   EYRAVAEALSMPRGSIGPTRGRCLGTLRAHLEAEGGSR"
     MGELRMTGER PPWEGLDGTD RHEVCVIAAR SGDRRALDVL IHDLTPLVWH VARGHGLDRS        60
     TAEDVVQTVW LALLRNLGRI TQPRALAGWL VVATRREAQR TWTPSRRESS LSDEMAEQQE       120
     SHIGLPEDAA LVDDRDQRLW RAFGKLSQRC QELLRLTVLA GRAEYRAVAE ALSMPRGSIG       180
     PTRGRCLGTL RAHLEAEGGS R                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page