(data stored in ACNUC7421 zone)

EMBL: CP001630.PE438

CP001630.PE438       Location/Qualifiers
FT   CDS             481427..482101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0445"
FT                   /product="CutC family protein"
FT                   /note="PFAM: CutC family protein; KEGG: bcj:BCAL0655 CutC
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34412"
FT                   /db_xref="GOA:C6WHW1"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHW1"
FT                   /inference="protein motif:PFAM:PF03932"
FT                   /protein_id="ACU34412.1"
FT                   /translation="MLEIIALTPADAAAAQAGGADRLELVADMVSDGLTPSAEVLRDVL
FT                   STTDLPVRVMLRDAPGFAPADPPSLRRAAALLREAGATEFVLGFLGDGGAVDRGACADL
FT                   LAELEGCAWTFHRALDNAADPEAAWPVAVGLGCDTVLAAGSARGVAEGIPVLERLAARQ
FT                   AADGVRLLVGGGLKREHVPGLARAGATSFHVGGAVRARGWDGPVSEPLVREWATLVAEA
FT                   RG"
     MLEIIALTPA DAAAAQAGGA DRLELVADMV SDGLTPSAEV LRDVLSTTDL PVRVMLRDAP        60
     GFAPADPPSL RRAAALLREA GATEFVLGFL GDGGAVDRGA CADLLAELEG CAWTFHRALD       120
     NAADPEAAWP VAVGLGCDTV LAAGSARGVA EGIPVLERLA ARQAADGVRL LVGGGLKREH       180
     VPGLARAGAT SFHVGGAVRA RGWDGPVSEP LVREWATLVA EARG                        224
//

If you have problems or comments...

PBIL Back to PBIL home page