(data stored in ACNUC7421 zone)

EMBL: CP001630.PE439

CP001630.PE439       Location/Qualifiers
FT   CDS             482648..483922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0446"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: rle:pRL100263 putative substrate-binding component of
FT                   ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34413"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHW2"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACU34413.1"
FT                   /translation="MRFLVAAATTALLLTGCAPVQSGPAPEGGDERAGQLRVWLFDEVN
FT                   RAPKEAVVARAVAEFEAAHEGVTVDVQHIQVASRAERFKAAFSDPASAPDVAEFGNTDL
FT                   AGYVAGGGFAPLDLGDWPDAADLAPRIAETGEVDGQLYGLPWYVGVRALYYRTDVFREL
FT                   DLQPPATLADLAPTARAIRAARPDLLGISAGGKYTYGALPFLWAAGGDVARERDGRHTS
FT                   ALTTPESLAGLRRYTELLADDICPPAQCAANGGDASVEAFRAGKAAMVIGGDFNRKSVD
FT                   DSTAGGKYAVVPLPGETAGSIAPAFAGGNLLGVLKGTRRRTLATEFVQLLGGKRYQREM
FT                   FDAMGNLPTFTDVQAEVAAANPALEPFTRTLEAGTRFVPATPDWAKVDAQGVLPTLIQE
FT                   VATGAKGLDAAAADAAARMNDAFGS"
     MRFLVAAATT ALLLTGCAPV QSGPAPEGGD ERAGQLRVWL FDEVNRAPKE AVVARAVAEF        60
     EAAHEGVTVD VQHIQVASRA ERFKAAFSDP ASAPDVAEFG NTDLAGYVAG GGFAPLDLGD       120
     WPDAADLAPR IAETGEVDGQ LYGLPWYVGV RALYYRTDVF RELDLQPPAT LADLAPTARA       180
     IRAARPDLLG ISAGGKYTYG ALPFLWAAGG DVARERDGRH TSALTTPESL AGLRRYTELL       240
     ADDICPPAQC AANGGDASVE AFRAGKAAMV IGGDFNRKSV DDSTAGGKYA VVPLPGETAG       300
     SIAPAFAGGN LLGVLKGTRR RTLATEFVQL LGGKRYQREM FDAMGNLPTF TDVQAEVAAA       360
     NPALEPFTRT LEAGTRFVPA TPDWAKVDAQ GVLPTLIQEV ATGAKGLDAA AADAAARMND       420
     AFGS                                                                    424
//

If you have problems or comments...

PBIL Back to PBIL home page