(data stored in ACNUC7421 zone)

EMBL: CP001630.PE44

CP001630.PE44        Location/Qualifiers
FT   CDS             47159..48991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0044"
FT                   /product="choline/carnitine/betaine transporter"
FT                   /note="TIGRFAM: choline/carnitine/betaine transporter;
FT                   PFAM: BCCT transporter; KEGG: ppw:PputW619_2676
FT                   choline/carnitine/betaine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34018"
FT                   /db_xref="GOA:C6WCJ7"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCJ7"
FT                   /inference="protein motif:TFAM:TIGR00842"
FT                   /protein_id="ACU34018.1"
FT                   /translation="MTTAEPQIKTPLPGEPKVDRPGRTDYVVFGVAAAITVAFLGWGVF
FT                   ATDSLASASKTALGWVMGNLGWAFVLLASGFVLFALWLAVSRYGRIPLGRDDERPEFTT
FT                   VSWIAMMFSAGMGIGLMFYGVNEPLTHFVNPPPGTVEAGSDAALRTAMATTLFHWTLHP
FT                   WAIYAVVGLAIAYSSFRRGRSQLISAAFAPLLGERTANGGVGKAIDVLAIFATLFGSAA
FT                   SLGLGALQIGSGLEIVGWAGEVGNAVLVGVIAVLTVAFIASAVSGVAKGIQWLSNVNMV
FT                   LAVVLALFLFVVGPTVFILNMVPTAIGEYFRELAEMTGRTAATGGDPMETWLSGWTVFY
FT                   WAWWIAWAPFVGMFIARISRGRTIRQFVAGVIGVPSLVSLMWFAIFGGTAIATQRGGAD
FT                   IAGQSTAEGQLFAVLREYPVASVSIVLVMVLVAIFFVSGADAASVVMGTLSQRGSIAPT
FT                   RGVVIFWGVVTGAVGAVMLLVGGSSGLTGLQNLTIIAALPFAVVMVGLCLSLARDLRSD
FT                   PMIRREERVAEVLEEVSTKIGPEEAALRAVESLTKGEGLSRAEKRVRSEAAGKAAEAEG
FT                   DEPAATGGVTAEGSTAQDVTAQDTTAEGGSLTKK"
     MTTAEPQIKT PLPGEPKVDR PGRTDYVVFG VAAAITVAFL GWGVFATDSL ASASKTALGW        60
     VMGNLGWAFV LLASGFVLFA LWLAVSRYGR IPLGRDDERP EFTTVSWIAM MFSAGMGIGL       120
     MFYGVNEPLT HFVNPPPGTV EAGSDAALRT AMATTLFHWT LHPWAIYAVV GLAIAYSSFR       180
     RGRSQLISAA FAPLLGERTA NGGVGKAIDV LAIFATLFGS AASLGLGALQ IGSGLEIVGW       240
     AGEVGNAVLV GVIAVLTVAF IASAVSGVAK GIQWLSNVNM VLAVVLALFL FVVGPTVFIL       300
     NMVPTAIGEY FRELAEMTGR TAATGGDPME TWLSGWTVFY WAWWIAWAPF VGMFIARISR       360
     GRTIRQFVAG VIGVPSLVSL MWFAIFGGTA IATQRGGADI AGQSTAEGQL FAVLREYPVA       420
     SVSIVLVMVL VAIFFVSGAD AASVVMGTLS QRGSIAPTRG VVIFWGVVTG AVGAVMLLVG       480
     GSSGLTGLQN LTIIAALPFA VVMVGLCLSL ARDLRSDPMI RREERVAEVL EEVSTKIGPE       540
     EAALRAVESL TKGEGLSRAE KRVRSEAAGK AAEAEGDEPA ATGGVTAEGS TAQDVTAQDT       600
     TAEGGSLTKK                                                              610
//

If you have problems or comments...

PBIL Back to PBIL home page