(data stored in ACNUC7421 zone)

EMBL: CP001630.PE440

CP001630.PE440       Location/Qualifiers
FT   CDS             483919..484830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0447"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mxa:MXAN_7294 putative
FT                   sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34414"
FT                   /db_xref="GOA:C6WHW3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHW3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACU34414.1"
FT                   /translation="MTVHSGRSDTRTALAYLAPALLVLVGLLGYPVYQLVVISLFDYGQ
FT                   EQVSGGAPLTFLGLGNYAELLRDSRFWSVLGQTAGFAALCVAGTLLVGATLAVVATRVR
FT                   PWARALLFLTALGAWSTPAVAGSTIWLFLFDASFGFVNEALTALGVEGARDFPWLYGKW
FT                   TAFGVVAAEVVWCSFPFVMLTLYAGIRSIPGEVLEAAALDGASTWRAARSVVLPLLRPL
FT                   LVIVTIQSVIWDFKVFTQVYVMTSGGGIAGRNLVLAVHAYQQAFAASEYGMGAAIGVVT
FT                   TALLLLLTAGYLRALRRGGEPL"
     MTVHSGRSDT RTALAYLAPA LLVLVGLLGY PVYQLVVISL FDYGQEQVSG GAPLTFLGLG        60
     NYAELLRDSR FWSVLGQTAG FAALCVAGTL LVGATLAVVA TRVRPWARAL LFLTALGAWS       120
     TPAVAGSTIW LFLFDASFGF VNEALTALGV EGARDFPWLY GKWTAFGVVA AEVVWCSFPF       180
     VMLTLYAGIR SIPGEVLEAA ALDGASTWRA ARSVVLPLLR PLLVIVTIQS VIWDFKVFTQ       240
     VYVMTSGGGI AGRNLVLAVH AYQQAFAASE YGMGAAIGVV TTALLLLLTA GYLRALRRGG       300
     EPL                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page