(data stored in ACNUC7421 zone)

EMBL: CP001630.PE441

CP001630.PE441       Location/Qualifiers
FT   CDS             484827..485660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0448"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rlt:Rleg2_3667
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34415"
FT                   /db_xref="GOA:C6WHW4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHW4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACU34415.1"
FT                   /translation="MRRWAWEAVAVGASLVVAFPLYWMVLTALKPAAEVVSAEPRPWTL
FT                   APSPDSFTRALTVESFGRYLANSLVVAVAVVLLSLVVSFLAATALTRFRFKGRTTMLVM
FT                   LLVVQMVPVEALTIPLFFLVRQVGSAVPVLGLNHLGSLVLVHLAFSLPFAIWMLRGFVA
FT                   AVPVELEEAATLDGASRTRFLWRVLFPLVAPGLVATSALSFIHAWNDFLFAKTFIISAE
FT                   ENQTLPLALQVFVRPDQNDWGAIMAGSTLMTLPVLVFFVLVRRNLVGGLAGAVKS"
     MRRWAWEAVA VGASLVVAFP LYWMVLTALK PAAEVVSAEP RPWTLAPSPD SFTRALTVES        60
     FGRYLANSLV VAVAVVLLSL VVSFLAATAL TRFRFKGRTT MLVMLLVVQM VPVEALTIPL       120
     FFLVRQVGSA VPVLGLNHLG SLVLVHLAFS LPFAIWMLRG FVAAVPVELE EAATLDGASR       180
     TRFLWRVLFP LVAPGLVATS ALSFIHAWND FLFAKTFIIS AEENQTLPLA LQVFVRPDQN       240
     DWGAIMAGST LMTLPVLVFF VLVRRNLVGG LAGAVKS                                277
//

If you have problems or comments...

PBIL Back to PBIL home page