(data stored in ACNUC7421 zone)

EMBL: CP001630.PE442

CP001630.PE442       Location/Qualifiers
FT   CDS             485657..487000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0449"
FT                   /product="Beta-N-acetylhexosaminidase"
FT                   /EC_number="3.2.1.52"
FT                   /note="PFAM: Glycoside hydrolase, family 20, catalytic
FT                   core; KEGG: nar:Saro_2417 beta-N-acetylhexosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34416"
FT                   /db_xref="GOA:C6WHW5"
FT                   /db_xref="InterPro:IPR015882"
FT                   /db_xref="InterPro:IPR015883"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025705"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHW5"
FT                   /inference="protein motif:PRIAM:3.2.1.52"
FT                   /protein_id="ACU34416.1"
FT                   /translation="MTLLPEPVSVVWGGGTVPWSTPVVRRAPGPAEGYRISISAGGVHV
FT                   DASDDAGEFYAHQTLRQLRGPDAFRAAPIRPDGPVPVCEIVDHPEHRWRGCMIDVARHF
FT                   LPKHDLLRYVDLLAAHKLNVLHLHLTDDQGWRVESERFPRLHEVGGWRPDSRWGDRRGG
FT                   LSTGRPHGGCYTRDDLREVVAYAAARHVTVVPEIDVPGHSQAAIAAYPELGVDGGGVWT
FT                   DWGVNPRVLNGSQSTVDFYRAVFDELLEVFPGEVVGFGGDEAPGGDGRFVRLIAEHLVA
FT                   RGRRPYGWDEVLDVEGLPEETVIAAWRSEEAVERALERGLDVVACPERHAYLDYRQSED
FT                   ADEPIPVGTVLTTEDVRAYRPVAGVLGAQANIWTEHLDSPRRLDYAAFPRLSAFAEVVW
FT                   NPAPVDGAGFAARLGAHLPRLAALGVEYRPPGGPLPWQRLPGVPGHPR"
     MTLLPEPVSV VWGGGTVPWS TPVVRRAPGP AEGYRISISA GGVHVDASDD AGEFYAHQTL        60
     RQLRGPDAFR AAPIRPDGPV PVCEIVDHPE HRWRGCMIDV ARHFLPKHDL LRYVDLLAAH       120
     KLNVLHLHLT DDQGWRVESE RFPRLHEVGG WRPDSRWGDR RGGLSTGRPH GGCYTRDDLR       180
     EVVAYAAARH VTVVPEIDVP GHSQAAIAAY PELGVDGGGV WTDWGVNPRV LNGSQSTVDF       240
     YRAVFDELLE VFPGEVVGFG GDEAPGGDGR FVRLIAEHLV ARGRRPYGWD EVLDVEGLPE       300
     ETVIAAWRSE EAVERALERG LDVVACPERH AYLDYRQSED ADEPIPVGTV LTTEDVRAYR       360
     PVAGVLGAQA NIWTEHLDSP RRLDYAAFPR LSAFAEVVWN PAPVDGAGFA ARLGAHLPRL       420
     AALGVEYRPP GGPLPWQRLP GVPGHPR                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page