(data stored in ACNUC7421 zone)

EMBL: CP001630.PE443

CP001630.PE443       Location/Qualifiers
FT   CDS             complement(487001..487255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0450"
FT                   /product="phage shock protein C, PspC"
FT                   /note="PFAM: PspC domain protein; KEGG: cbc:CbuK_0644
FT                   stress-responsive transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34417"
FT                   /db_xref="GOA:C6WHW6"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHW6"
FT                   /inference="protein motif:PFAM:PF04024"
FT                   /protein_id="ACU34417.1"
FT                   /translation="MTNNSLNDAAAKLGEATAQATTKVKQFRRSRTDRMIAGVCGGAAK
FT                   MLGIDAALLRILLVAATLFGVGAGAILYLAAWIFVPEEA"
     MTNNSLNDAA AKLGEATAQA TTKVKQFRRS RTDRMIAGVC GGAAKMLGID AALLRILLVA        60
     ATLFGVGAGA ILYLAAWIFV PEEA                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page