(data stored in ACNUC7421 zone)

EMBL: CP001630.PE444

CP001630.PE444       Location/Qualifiers
FT   CDS             487494..488600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0451"
FT                   /product="protein of unknown function DUF182"
FT                   /note="PFAM: protein of unknown function DUF182; KEGG:
FT                   msl:Msil_0236 protein of unknown function DUF182"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34418"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHW7"
FT                   /inference="protein motif:PFAM:PF02625"
FT                   /protein_id="ACU34418.1"
FT                   /translation="MRDVLPDLVRRVAAGEVVGVGTVVATFSSAPRPPGAAMLVGADGA
FT                   AVGSVSGGCVEGAVHELALGVVGGGAPVLRRFGVSDDDAFDVGLTCGGIIDVYVEAVSA
FT                   AGFPELPLVDASVRAGEAVAVATAVEHPTRAGARLVVWPDRVAGGLGSARVDDAVADDA
FT                   RGLLAAGRSGVLRYGPDGQRRGEGLSVFVNSFEPPPRLLVFGAIDFAAAMARLGAFLGY
FT                   RVTVCDARPVFATAARFPQADEVVVDWPHRYLAAEAAAGRVDRRTAVAVLTHDPKFDVP
FT                   LLEVALRLDLGYVGAMGSRRAHHDRTARLRAAGVGEAELGRLSSPIGLDLGARTPEETA
FT                   VSIAAEMIALRWGGGGARLTTTEGAIHR"
     MRDVLPDLVR RVAAGEVVGV GTVVATFSSA PRPPGAAMLV GADGAAVGSV SGGCVEGAVH        60
     ELALGVVGGG APVLRRFGVS DDDAFDVGLT CGGIIDVYVE AVSAAGFPEL PLVDASVRAG       120
     EAVAVATAVE HPTRAGARLV VWPDRVAGGL GSARVDDAVA DDARGLLAAG RSGVLRYGPD       180
     GQRRGEGLSV FVNSFEPPPR LLVFGAIDFA AAMARLGAFL GYRVTVCDAR PVFATAARFP       240
     QADEVVVDWP HRYLAAEAAA GRVDRRTAVA VLTHDPKFDV PLLEVALRLD LGYVGAMGSR       300
     RAHHDRTARL RAAGVGEAEL GRLSSPIGLD LGARTPEETA VSIAAEMIAL RWGGGGARLT       360
     TTEGAIHR                                                                368
//

If you have problems or comments...

PBIL Back to PBIL home page