(data stored in ACNUC7421 zone)

EMBL: CP001630.PE445

CP001630.PE445       Location/Qualifiers
FT   CDS             489427..490365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0452"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: bca:BCE_2879 mandelate racemase/muconate
FT                   lactonizing enzyme family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34419"
FT                   /db_xref="GOA:C6WHW8"
FT                   /db_xref="InterPro:IPR010196"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="InterPro:IPR041338"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHW8"
FT                   /inference="protein motif:PFAM:PF01188"
FT                   /protein_id="ACU34419.1"
FT                   /translation="MLVYSIPMRTRFRGITVREGVLLEGERGWGEFCAFLDYSDAECAP
FT                   WLACAVEAAEEGWPAPVRERVAVNCTVPVVSPERAHALVSASGCGTAKVKVADPGAPLA
FT                   EDLERVAAVRDALGPGGAVRVDANAAWDVDTAVTAIRALDRAAGGLEYVEQPCRTVEEL
FT                   AAVRRRVDVRIAADESIRRAEDPLRVAVAGAADVAVIKVAPLGGVRRALRVAEACGLPC
FT                   VVSSAVETSVGMAAGLALAGALPELDFACGLGTLPLLDGDVATASLVPVDGWLPVPTAP
FT                   PVPDRAERFAADPETTLRWRERLARVGRPRG"
     MLVYSIPMRT RFRGITVREG VLLEGERGWG EFCAFLDYSD AECAPWLACA VEAAEEGWPA        60
     PVRERVAVNC TVPVVSPERA HALVSASGCG TAKVKVADPG APLAEDLERV AAVRDALGPG       120
     GAVRVDANAA WDVDTAVTAI RALDRAAGGL EYVEQPCRTV EELAAVRRRV DVRIAADESI       180
     RRAEDPLRVA VAGAADVAVI KVAPLGGVRR ALRVAEACGL PCVVSSAVET SVGMAAGLAL       240
     AGALPELDFA CGLGTLPLLD GDVATASLVP VDGWLPVPTA PPVPDRAERF AADPETTLRW       300
     RERLARVGRP RG                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page