(data stored in ACNUC7421 zone)

EMBL: CP001630.PE446

CP001630.PE446       Location/Qualifiers
FT   CDS             complement(490565..492217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0453"
FT                   /product="type III restriction protein res subunit"
FT                   /note="PFAM: type III restriction protein res subunit;
FT                   helicase domain protein; SMART: DEAD-like helicase;
FT                   helicase domain protein; KEGG: SSL2; DNA helicase; K10843
FT                   DNA excision repair protein ERCC-3"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34420"
FT                   /db_xref="GOA:C6WHW9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032438"
FT                   /db_xref="InterPro:IPR032830"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHW9"
FT                   /inference="protein motif:PFAM:PF04851"
FT                   /protein_id="ACU34420.1"
FT                   /translation="MTDGPLIVQSDKTLLLEVDHPAADEARAAIAPFAELERAPEHVHT
FT                   YRVTPLALWNARAAGHDAEQVVDALVRFSRYPVPQPLLVDVVDVMGRYGRLQLSTHPAH
FT                   GLVLQSLDRAVLEEVLRHKKIKPMFGARIDDDTVVVHASERGRLKQLLLKVGWPAEDLA
FT                   GYVDGEAHPIELVEEGWQLRDYQRLAAQAFRAGGSGVVVLPCGAGKTMVGAAAMAEAGA
FT                   TTLILVTNTVAGRQWKRELVARTSLTEDEIGEYSGERKEIRPVTIATYQVITRKSKGEY
FT                   KHLELFDSRDWGLIVYDEVHLLPAPVFRMTADLQSRRRLGLTATLVREDGQEGEVFSLI
FT                   GPKRFDVPWRDIEAQGWIAPAECTEVRVTLTDAERLGYATAEPEERYKLCSTARTKLPV
FT                   VKAVLDKHPGEPALVIGAYLDQLEELGEALGAPVVQGATKNKEREELFDAFRRGELSTL
FT                   VVSKVANFSIDLPEASVAVQVSGTFGSRQEEAQRLGRLLRPKADGRQAHFYSVVSRDTL
FT                   DTDYAAHRQRFLAEQGYAYRIVDADDLLGPKIG"
     MTDGPLIVQS DKTLLLEVDH PAADEARAAI APFAELERAP EHVHTYRVTP LALWNARAAG        60
     HDAEQVVDAL VRFSRYPVPQ PLLVDVVDVM GRYGRLQLST HPAHGLVLQS LDRAVLEEVL       120
     RHKKIKPMFG ARIDDDTVVV HASERGRLKQ LLLKVGWPAE DLAGYVDGEA HPIELVEEGW       180
     QLRDYQRLAA QAFRAGGSGV VVLPCGAGKT MVGAAAMAEA GATTLILVTN TVAGRQWKRE       240
     LVARTSLTED EIGEYSGERK EIRPVTIATY QVITRKSKGE YKHLELFDSR DWGLIVYDEV       300
     HLLPAPVFRM TADLQSRRRL GLTATLVRED GQEGEVFSLI GPKRFDVPWR DIEAQGWIAP       360
     AECTEVRVTL TDAERLGYAT AEPEERYKLC STARTKLPVV KAVLDKHPGE PALVIGAYLD       420
     QLEELGEALG APVVQGATKN KEREELFDAF RRGELSTLVV SKVANFSIDL PEASVAVQVS       480
     GTFGSRQEEA QRLGRLLRPK ADGRQAHFYS VVSRDTLDTD YAAHRQRFLA EQGYAYRIVD       540
     ADDLLGPKIG                                                              550
//

If you have problems or comments...

PBIL Back to PBIL home page