(data stored in ACNUC7421 zone)

EMBL: CP001630.PE447

CP001630.PE447       Location/Qualifiers
FT   CDS             492343..492873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0454"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34421"
FT                   /db_xref="GOA:C6WHX0"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHX0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34421.1"
FT                   /translation="MSSDDARNDTGGKPAPNRRVLAIAAVAVVVLAVAGYAVHVLTGPG
FT                   SSAGECVRITGADGDSLAVTPDDCDADLANFRVGKVVDGADAPCPEEGVYTEARGQGSS
FT                   TLCLLPNMVEGACYGPDDRGFGGLVKSACAGEATIKVTKVIEGSTDTSGCPDGAGMSYP
FT                   EPPITFCVVPADL"
     MSSDDARNDT GGKPAPNRRV LAIAAVAVVV LAVAGYAVHV LTGPGSSAGE CVRITGADGD        60
     SLAVTPDDCD ADLANFRVGK VVDGADAPCP EEGVYTEARG QGSSTLCLLP NMVEGACYGP       120
     DDRGFGGLVK SACAGEATIK VTKVIEGSTD TSGCPDGAGM SYPEPPITFC VVPADL           176
//

If you have problems or comments...

PBIL Back to PBIL home page