(data stored in ACNUC7421 zone)

EMBL: CP001630.PE448

CP001630.PE448       Location/Qualifiers
FT   CDS             492929..493387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34422"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHX1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34422.1"
FT                   /translation="MRESGWLIGAAALVLAGGWLLAAPTAGEDLPSAGDCASFVGTADA
FT                   PGYAALDCGAEQANARVLGVADVADACPGSDARPTAGGAVCLGPNLVAGHCYRDDLQMG
FT                   LVRVTCDTFGAVKVLKVANSTFPCEEGDLLTLGDRSIAFCVTRAADSR"
     MRESGWLIGA AALVLAGGWL LAAPTAGEDL PSAGDCASFV GTADAPGYAA LDCGAEQANA        60
     RVLGVADVAD ACPGSDARPT AGGAVCLGPN LVAGHCYRDD LQMGLVRVTC DTFGAVKVLK       120
     VANSTFPCEE GDLLTLGDRS IAFCVTRAAD SR                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page