(data stored in ACNUC7421 zone)

EMBL: CP001630.PE449

CP001630.PE449       Location/Qualifiers
FT   CDS             493478..494566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0456"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Prp2; proline rich protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34423"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHX2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34423.1"
FT                   /translation="MTTPPEGPQDPWQPSWRPEPERRPEHSGPAVTPPQRAAQPVFPSQ
FT                   DAPWGAPTGHDRSPDPWPAARPAARPGAADPGPGPRHDPRTEPETPPTGLAQFGFTGEP
FT                   ADRSAFTVNGRISRKSEFAGQRDPARFPDFHRDERSAPPPSDDSLGYAVLVQPLGPGSA
FT                   PAPEVRYRQPWQPTHQEQHPHGPVPAHGTGLARRTKIVLALAAVVPLAAIVALSFGGED
FT                   RRTAVAGAEAGDCLKVNEVSRDGADVEMVDCAAGDAAYRVAVNLPETDRCPPGDYDEYI
FT                   RGGAGNRGFRLCLMLNATDGDCFKEEGGIAASKTTKVRCGSGATYKVAKAHSGTVDELV
FT                   CEFDENPRVYPTPPTTLCITDP"
     MTTPPEGPQD PWQPSWRPEP ERRPEHSGPA VTPPQRAAQP VFPSQDAPWG APTGHDRSPD        60
     PWPAARPAAR PGAADPGPGP RHDPRTEPET PPTGLAQFGF TGEPADRSAF TVNGRISRKS       120
     EFAGQRDPAR FPDFHRDERS APPPSDDSLG YAVLVQPLGP GSAPAPEVRY RQPWQPTHQE       180
     QHPHGPVPAH GTGLARRTKI VLALAAVVPL AAIVALSFGG EDRRTAVAGA EAGDCLKVNE       240
     VSRDGADVEM VDCAAGDAAY RVAVNLPETD RCPPGDYDEY IRGGAGNRGF RLCLMLNATD       300
     GDCFKEEGGI AASKTTKVRC GSGATYKVAK AHSGTVDELV CEFDENPRVY PTPPTTLCIT       360
     DP                                                                      362
//

If you have problems or comments...

PBIL Back to PBIL home page