(data stored in ACNUC7421 zone)

EMBL: CP001630.PE45

CP001630.PE45        Location/Qualifiers
FT   CDS             complement(49044..49484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34019"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCJ8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34019.1"
FT                   /translation="MARRTARKRGISPSGAKNLVGVAKVVVPALLPVLAPLAARAASAA
FT                   GDRYDRYRAARLGVDVERLAEYSGRGARLHARISNAGAALAGLVDEDAGYAQRCQQRLA
FT                   QLQAAVRASEGMPAPRRKAAHRAVAADLDAVEGELLKRLGVD"
     MARRTARKRG ISPSGAKNLV GVAKVVVPAL LPVLAPLAAR AASAAGDRYD RYRAARLGVD        60
     VERLAEYSGR GARLHARISN AGAALAGLVD EDAGYAQRCQ QRLAQLQAAV RASEGMPAPR       120
     RKAAHRAVAA DLDAVEGELL KRLGVD                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page