(data stored in ACNUC7421 zone)

EMBL: CP001630.PE450

CP001630.PE450       Location/Qualifiers
FT   CDS             complement(494631..495632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0457"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   systems periplasmic components"
FT                   /note="KEGG: twin-arginine translocation pathway signal;
FT                   K02051 sulfonate/nitrate/taurine transport system
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34424"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHX3"
FT                   /inference="protein motif:COG:COG0715"
FT                   /protein_id="ACU34424.1"
FT                   /translation="MPTPARVLRRAAALIVCATTLSACGLLPGTSGDETPALERNTLRI
FT                   GVLPVVDVAPLKLALNDKLFERAGLQVQLVDVSSEDEGLKQLDSTLDITWGSHVKLFSK
FT                   VAEGTELQIQGEAYQAGANSMALVTTNPQYDSAEKIKARSANRKPKIAVDSTKDLGALT
FT                   TTSVLQTAGIQSSGVEMVTMPFSQMVNDLRADKVQAAWMIEPYITKAQREVGARVITDT
FT                   ATGPTQDFPMSGYASSKKFADANPQTLKLFRSVLQEAQQAASDDKLAVQDVLTSYIDVD
FT                   QQTAALVSIGTFPVSLNSVRLQRVADMMDTADVLVGKLDVQVLLPEGTASTG"
     MPTPARVLRR AAALIVCATT LSACGLLPGT SGDETPALER NTLRIGVLPV VDVAPLKLAL        60
     NDKLFERAGL QVQLVDVSSE DEGLKQLDST LDITWGSHVK LFSKVAEGTE LQIQGEAYQA       120
     GANSMALVTT NPQYDSAEKI KARSANRKPK IAVDSTKDLG ALTTTSVLQT AGIQSSGVEM       180
     VTMPFSQMVN DLRADKVQAA WMIEPYITKA QREVGARVIT DTATGPTQDF PMSGYASSKK       240
     FADANPQTLK LFRSVLQEAQ QAASDDKLAV QDVLTSYIDV DQQTAALVSI GTFPVSLNSV       300
     RLQRVADMMD TADVLVGKLD VQVLLPEGTA STG                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page