(data stored in ACNUC7421 zone)

EMBL: CP001630.PE451

CP001630.PE451       Location/Qualifiers
FT   CDS             496042..499320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0458"
FT                   /product="putative sensor with HAMP domain"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; Nitrate and
FT                   nitrite sensing domain protein; SMART: ATP-binding region
FT                   ATPase domain protein; KEGG: mag:amb3383 methyl-accepting
FT                   chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34425"
FT                   /db_xref="GOA:C6WHX4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR013587"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHX4"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACU34425.1"
FT                   /translation="MGDGLAALRDGTVTESTGTGLTTGVRQGEARTASWRLQNWRLPTK
FT                   LGAVLLIPTVAALALGGLRVQSDLANATQFSRLANQVQLETAVADLVHQLQRERDLSTW
FT                   YVASSKQIESVALDRQLVRVSDAVETLKSKIIDLSGDLAPETVERFRGTAEQLTRLNSL
FT                   RSAVRETQYPSDAVLRVYSESVESLLDLGEQAIGGIDDPELARLHLATNAMARIKEQES
FT                   QKRGILFDVFQRGSFAANQERALLAVNAELDAARNDFRKSATPDQAKIYDDTVTGLIID
FT                   TANNMQETALNLAGTTSGFGDISPKGWDVSSTLTVNKTRQVEVMLIEQLQRLSDERTGE
FT                   ARAAAFYDSGVVLGALLMALVMALFVARSILNPLRLLRRTALDVADKGLPEAVEKILAD
FT                   PNPQEAAKTAIAPVPITTREEVGQVARAFDAVHGEAVRLAAEQAMLRDNVNAMFVNLSR
FT                   RSQALVERQLNLIDRLEQDEQDPDQLASLFELDHLATRMRRNSENLLMLSGTDLSRRLT
FT                   RPVPVAEVLGAAVSEVEQYARVQVGQTPELTVQGRAVNDLVHLIAELLDNATAFSDPVT
FT                   KVTVRTARTRKGELAIEIQDRGVGMSDQDLRDANERLANPPDVDVAVSRRMGLYVVARL
FT                   AKRHDVKVRLRGNEDIEGGTTALVTVPEALVTSAGQTAHPMGADLIGSPSAPAPSAFPS
FT                   PNTAQRASGIAGAFGGGNGTAGVTSRHDEESSYPAVSFMSTDVDADATRAPYRAEVPQE
FT                   TSAEISQASWLPMVEEQPPAVARDAQNEPTGTFGSPTLFTAYEDRDAPQADHEHGYQTT
FT                   QFPAVDDSANAFAPFAAPLPEPEPEPEPEPEPEPVVFQRSSAPRASAPARPVVDDTPTE
FT                   RLPIYEAVLSQWFQSVGSETSAATTQAVPPAPAAPAPRPARQDVQPEPQREEAPLPTRK
FT                   PRPVSEQAQEAAAPSSAIENGLPKRQPGSQSNMSKRTLETSRVSEPEAVQAEPAAKASP
FT                   ASVWQSPADEGWQAAQSLLSSTPDATTQAGLPKRKPKAQLVPGSAAPLAGATQQPQQPP
FT                   LPPRSADVIRGRMSSLQQGVRRGRHALIDAYAGDMSSRQDEEQE"
     MGDGLAALRD GTVTESTGTG LTTGVRQGEA RTASWRLQNW RLPTKLGAVL LIPTVAALAL        60
     GGLRVQSDLA NATQFSRLAN QVQLETAVAD LVHQLQRERD LSTWYVASSK QIESVALDRQ       120
     LVRVSDAVET LKSKIIDLSG DLAPETVERF RGTAEQLTRL NSLRSAVRET QYPSDAVLRV       180
     YSESVESLLD LGEQAIGGID DPELARLHLA TNAMARIKEQ ESQKRGILFD VFQRGSFAAN       240
     QERALLAVNA ELDAARNDFR KSATPDQAKI YDDTVTGLII DTANNMQETA LNLAGTTSGF       300
     GDISPKGWDV SSTLTVNKTR QVEVMLIEQL QRLSDERTGE ARAAAFYDSG VVLGALLMAL       360
     VMALFVARSI LNPLRLLRRT ALDVADKGLP EAVEKILADP NPQEAAKTAI APVPITTREE       420
     VGQVARAFDA VHGEAVRLAA EQAMLRDNVN AMFVNLSRRS QALVERQLNL IDRLEQDEQD       480
     PDQLASLFEL DHLATRMRRN SENLLMLSGT DLSRRLTRPV PVAEVLGAAV SEVEQYARVQ       540
     VGQTPELTVQ GRAVNDLVHL IAELLDNATA FSDPVTKVTV RTARTRKGEL AIEIQDRGVG       600
     MSDQDLRDAN ERLANPPDVD VAVSRRMGLY VVARLAKRHD VKVRLRGNED IEGGTTALVT       660
     VPEALVTSAG QTAHPMGADL IGSPSAPAPS AFPSPNTAQR ASGIAGAFGG GNGTAGVTSR       720
     HDEESSYPAV SFMSTDVDAD ATRAPYRAEV PQETSAEISQ ASWLPMVEEQ PPAVARDAQN       780
     EPTGTFGSPT LFTAYEDRDA PQADHEHGYQ TTQFPAVDDS ANAFAPFAAP LPEPEPEPEP       840
     EPEPEPVVFQ RSSAPRASAP ARPVVDDTPT ERLPIYEAVL SQWFQSVGSE TSAATTQAVP       900
     PAPAAPAPRP ARQDVQPEPQ REEAPLPTRK PRPVSEQAQE AAAPSSAIEN GLPKRQPGSQ       960
     SNMSKRTLET SRVSEPEAVQ AEPAAKASPA SVWQSPADEG WQAAQSLLSS TPDATTQAGL      1020
     PKRKPKAQLV PGSAAPLAGA TQQPQQPPLP PRSADVIRGR MSSLQQGVRR GRHALIDAYA      1080
     GDMSSRQDEE QE                                                          1092
//

If you have problems or comments...

PBIL Back to PBIL home page