(data stored in ACNUC7421 zone)

EMBL: CP001630.PE452

CP001630.PE452       Location/Qualifiers
FT   CDS             499317..499736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0459"
FT                   /product="Roadblock/LC7 family protein"
FT                   /note="PFAM: Roadblock/LC7 family protein; KEGG:
FT                   pna:Pnap_2813 roadblock/LC7 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34426"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHX5"
FT                   /inference="protein motif:PFAM:PF03259"
FT                   /protein_id="ACU34426.1"
FT                   /translation="MTTAAQPGSFGWLITDFVRRVPGVAHSVVVSADGLLLAGSQGLPR
FT                   DRAEQLSAVASGLVSLTTGAARCFEAGTVNQTVVEMERGYLFLMSISDGSCLAVLAAPN
FT                   CDIGLVAYEMTLLVERVGQQLTPELRAQLQGVVRR"
     MTTAAQPGSF GWLITDFVRR VPGVAHSVVV SADGLLLAGS QGLPRDRAEQ LSAVASGLVS        60
     LTTGAARCFE AGTVNQTVVE MERGYLFLMS ISDGSCLAVL AAPNCDIGLV AYEMTLLVER       120
     VGQQLTPELR AQLQGVVRR                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page