(data stored in ACNUC7421 zone)

EMBL: CP001630.PE453

CP001630.PE453       Location/Qualifiers
FT   CDS             499962..500510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0460"
FT                   /product="protein of unknown function DUF742"
FT                   /note="PFAM: protein of unknown function DUF742"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34427"
FT                   /db_xref="InterPro:IPR007995"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHX6"
FT                   /inference="protein motif:PFAM:PF05331"
FT                   /protein_id="ACU34427.1"
FT                   /translation="MAQREVEDSSYDYDDVPNRFDIDGYGSGLFGGPGADLFGAHGLPE
FT                   SVPEQLPYTTGPQPVVRQEEHPAAESGSLVRPYTRTGGRTRPDYDLAIEALISTSERGL
FT                   ERDAAVLPEHRSICGLCTDTRSVAEVAALLRLPLGVARVLIGDMASMGLVLIHQGGMVV
FT                   GDKPSIDFLERVLSGLRRL"
     MAQREVEDSS YDYDDVPNRF DIDGYGSGLF GGPGADLFGA HGLPESVPEQ LPYTTGPQPV        60
     VRQEEHPAAE SGSLVRPYTR TGGRTRPDYD LAIEALISTS ERGLERDAAV LPEHRSICGL       120
     CTDTRSVAEV AALLRLPLGV ARVLIGDMAS MGLVLIHQGG MVVGDKPSID FLERVLSGLR       180
     RL                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page