(data stored in ACNUC7421 zone)

EMBL: CP001630.PE454

CP001630.PE454       Location/Qualifiers
FT   CDS             500491..501099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0461"
FT                   /product="protein of unknown function ATP binding"
FT                   /note="PFAM: protein of unknown function ATP binding; KEGG:
FT                   nmn:NMCC_1665 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34428"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHX7"
FT                   /inference="protein motif:PFAM:PF03029"
FT                   /protein_id="ACU34428.1"
FT                   /translation="MGFAGSSPNAAAEGARKPTTSAKIVVAGGFGVGKTTFVGSVSEIV
FT                   PLTTEAVMTEASAGVDDLSATPNKVTTTVAMDFGRVSLDSDLILYLFGTPGQHRFWFMW
FT                   DDLVRGAIGAIVLVDTRRLADAFASIDFFDDRQLPYVVGVNCFDGLLHHRIEDVREALT
FT                   IDQSVPIVTCDARNRQSTKQTLITLVEHAMRQWMSVRAG"
     MGFAGSSPNA AAEGARKPTT SAKIVVAGGF GVGKTTFVGS VSEIVPLTTE AVMTEASAGV        60
     DDLSATPNKV TTTVAMDFGR VSLDSDLILY LFGTPGQHRF WFMWDDLVRG AIGAIVLVDT       120
     RRLADAFASI DFFDDRQLPY VVGVNCFDGL LHHRIEDVRE ALTIDQSVPI VTCDARNRQS       180
     TKQTLITLVE HAMRQWMSVR AG                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page