(data stored in ACNUC7421 zone)

EMBL: CP001630.PE455

CP001630.PE455       Location/Qualifiers
FT   CDS             complement(501188..502924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0462"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dac:Daci_2082 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34429"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHX8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34429.1"
FT                   /translation="MAIFRRGALVLAVAAATCAFSAGNALATPVAPEASTGAEAERTAP
FT                   GATERLLDLDGDIDLSLSLGGDDHWCHWWTLDDLQDVLGDSPVWSVGDLEDLLDGTTVV
FT                   LDPSDLDDLFDNVLDHTHAVDVDDLLGGNGLLGDIDLDVDAVLGSGGGLLDLGDLLGDG
FT                   DLLGDDLLDLDAVLDLDLNSGNDGLLGGLLGDGDGLLGIDGLLDDGLLDLDAVLDLDLD
FT                   GLLDLDDLLDIDLDADVDADLSIGGGNDGVIVLPGTGSGSGLPSLPGVSGGDSTSGGDT
FT                   APGTVVPGATLPGAVTGLPGTVTDTVEDVTDAVGGIGEVAGDAGEVAGDLTDTAGDIVS
FT                   GAGDLVSGAGDIVDTATTGVQDVLSGASNAVTSATDLASSIAQAATNPITSIAGSNPAT
FT                   APTLPAVTAPTAPVASNPLGTVTSAVGSVLGSVKPVTATVSGSGSLTGSLTGGDSKEGV
FT                   PAQQQPVEQAVEAVQPAVAEVAPAATDIVMTTTAAPMAEAQEDVTEVASDGRLSAAEWL
FT                   WLIHHHDNDGLLGDLLDDLLGLDLDIDADVDLDLGGHGHGGLLGLGGHHGGLLGGLLNI
FT                   GG"
     MAIFRRGALV LAVAAATCAF SAGNALATPV APEASTGAEA ERTAPGATER LLDLDGDIDL        60
     SLSLGGDDHW CHWWTLDDLQ DVLGDSPVWS VGDLEDLLDG TTVVLDPSDL DDLFDNVLDH       120
     THAVDVDDLL GGNGLLGDID LDVDAVLGSG GGLLDLGDLL GDGDLLGDDL LDLDAVLDLD       180
     LNSGNDGLLG GLLGDGDGLL GIDGLLDDGL LDLDAVLDLD LDGLLDLDDL LDIDLDADVD       240
     ADLSIGGGND GVIVLPGTGS GSGLPSLPGV SGGDSTSGGD TAPGTVVPGA TLPGAVTGLP       300
     GTVTDTVEDV TDAVGGIGEV AGDAGEVAGD LTDTAGDIVS GAGDLVSGAG DIVDTATTGV       360
     QDVLSGASNA VTSATDLASS IAQAATNPIT SIAGSNPATA PTLPAVTAPT APVASNPLGT       420
     VTSAVGSVLG SVKPVTATVS GSGSLTGSLT GGDSKEGVPA QQQPVEQAVE AVQPAVAEVA       480
     PAATDIVMTT TAAPMAEAQE DVTEVASDGR LSAAEWLWLI HHHDNDGLLG DLLDDLLGLD       540
     LDIDADVDLD LGGHGHGGLL GLGGHHGGLL GGLLNIGG                               578
//

If you have problems or comments...

PBIL Back to PBIL home page