(data stored in ACNUC7421 zone)

EMBL: CP001630.PE456

CP001630.PE456       Location/Qualifiers
FT   CDS             complement(503041..505284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0463"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: acp:A2cp1_2891 response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34430"
FT                   /db_xref="InterPro:IPR032830"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHX9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34430.1"
FT                   /translation="MSGTTLADWLRAQDDKVLVALLRARPDLATPPPADTSVLATRLGS
FT                   RSSVARACEDLDSLALTALEALLVLDADRAPVPISALRALFKPHRVTVARPVALLRSRG
FT                   LLWGPDSALRVPASARDAVSPFPCGLGRSAPSLADVDLSGLDEGESRVLAALATGRPTG
FT                   QTKDAAHVVSLERATSPIQKLLARGLLVRRDQSTVELPREVGLAVRGDRPLGDVVAEEP
FT                   ALRTQALDPGRVDGTGAGAVLELVRHVEGLVGSWSQEPPAVLRSGGLGVRELRRVAKDL
FT                   DVTEERAALLVELAVAAGLVGDSAGLEPEWVPTAQADPWLAAGPEQRWAVLAQAWLELG
FT                   RLPGLVGGRDDRDRPLNPLAPELARAAAPKDRRRVLEALAELEPGTAVPDVAGLAATLA
FT                   WRAPRRGGRLRDELVRWTVEEGTALGVLALGAATGAGRALLGEGAAAAAKRLADALPDP
FT                   VDHVLVQADLTVVAPGRLEPELAGEMALVADVESAGHATVYRVDERTVRRALDSGRTAD
FT                   DLHELFRSRSRTPVPQSLTYLVDDTARKHGRLRGGPAGSFLRCDDPVLVAEVLAHPASD
FT                   ALELRRIAPTVLVSPLPLAEVLAGLRGAGFAPVAEDAGGQVVDLRAGGRRITGRGRRKS
FT                   PPPPTASPEQLAELVRQLRAGDRAATTTAGARVTVPGNLGSGPSVTLAVLQQAAREGGE
FT                   VLVDFVDGHGTAASRVIKPQVVGGGVLEGVDVGYGEVRRFPLHRITSVAIVHK"
     MSGTTLADWL RAQDDKVLVA LLRARPDLAT PPPADTSVLA TRLGSRSSVA RACEDLDSLA        60
     LTALEALLVL DADRAPVPIS ALRALFKPHR VTVARPVALL RSRGLLWGPD SALRVPASAR       120
     DAVSPFPCGL GRSAPSLADV DLSGLDEGES RVLAALATGR PTGQTKDAAH VVSLERATSP       180
     IQKLLARGLL VRRDQSTVEL PREVGLAVRG DRPLGDVVAE EPALRTQALD PGRVDGTGAG       240
     AVLELVRHVE GLVGSWSQEP PAVLRSGGLG VRELRRVAKD LDVTEERAAL LVELAVAAGL       300
     VGDSAGLEPE WVPTAQADPW LAAGPEQRWA VLAQAWLELG RLPGLVGGRD DRDRPLNPLA       360
     PELARAAAPK DRRRVLEALA ELEPGTAVPD VAGLAATLAW RAPRRGGRLR DELVRWTVEE       420
     GTALGVLALG AATGAGRALL GEGAAAAAKR LADALPDPVD HVLVQADLTV VAPGRLEPEL       480
     AGEMALVADV ESAGHATVYR VDERTVRRAL DSGRTADDLH ELFRSRSRTP VPQSLTYLVD       540
     DTARKHGRLR GGPAGSFLRC DDPVLVAEVL AHPASDALEL RRIAPTVLVS PLPLAEVLAG       600
     LRGAGFAPVA EDAGGQVVDL RAGGRRITGR GRRKSPPPPT ASPEQLAELV RQLRAGDRAA       660
     TTTAGARVTV PGNLGSGPSV TLAVLQQAAR EGGEVLVDFV DGHGTAASRV IKPQVVGGGV       720
     LEGVDVGYGE VRRFPLHRIT SVAIVHK                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page