(data stored in ACNUC7421 zone)

EMBL: CP001630.PE458

CP001630.PE458       Location/Qualifiers
FT   CDS             505641..507044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0465"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating)"
FT                   /EC_number="1.1.1.38"
FT                   /note="PFAM: malic protein NAD-binding; malic protein
FT                   domain protein; KEGG: sat:SYN_00517 NAD-dependent malic
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34432"
FT                   /db_xref="GOA:C6WHY1"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHY1"
FT                   /inference="protein motif:PRIAM:1.1.1.38"
FT                   /protein_id="ACU34432.1"
FT                   /translation="MPVPGPGYSITVRLEAPPSASAAGDLTSAVGRAGGVITAFDVVES
FT                   HNDRVIIDLTCNALSANHAKDITDTLEQLPGIVVRKVSDRTFLVHLGGKIEISSKVPLR
FT                   NRDDLSRAYTPGVARVCQAIAENPEDARRLTIKRNTVAVVTDGSAVLGLGNLGPAAALP
FT                   VMEGKAALFKKFAGVDAWPVCLDTQDTEEIIRAVELIAPVYGGINLEDIAAPRCFEIEA
FT                   RLREKLDIPVFHDDQHGTAIVVVGALRNALRVVGKDISECKIVVCGVGAAGSAIIRLLL
FT                   KQTPGDVVAVDVDGIVHRDRPGMDPNLASVAESTNKENVSGRLHDALVGADVFIGVSAP
FT                   NLFGAEQVATMNSDAIVFALANPDPEIDPMEAQKHAAVVATGRSDFPNQINNVLAFPGV
FT                   FRGLLDANANTITDEMLLAAATAIADVVDGDRLNASFIVPSVFDTTVAPAVAEAVRKVA
FT                   SELKAAERA"
     MPVPGPGYSI TVRLEAPPSA SAAGDLTSAV GRAGGVITAF DVVESHNDRV IIDLTCNALS        60
     ANHAKDITDT LEQLPGIVVR KVSDRTFLVH LGGKIEISSK VPLRNRDDLS RAYTPGVARV       120
     CQAIAENPED ARRLTIKRNT VAVVTDGSAV LGLGNLGPAA ALPVMEGKAA LFKKFAGVDA       180
     WPVCLDTQDT EEIIRAVELI APVYGGINLE DIAAPRCFEI EARLREKLDI PVFHDDQHGT       240
     AIVVVGALRN ALRVVGKDIS ECKIVVCGVG AAGSAIIRLL LKQTPGDVVA VDVDGIVHRD       300
     RPGMDPNLAS VAESTNKENV SGRLHDALVG ADVFIGVSAP NLFGAEQVAT MNSDAIVFAL       360
     ANPDPEIDPM EAQKHAAVVA TGRSDFPNQI NNVLAFPGVF RGLLDANANT ITDEMLLAAA       420
     TAIADVVDGD RLNASFIVPS VFDTTVAPAV AEAVRKVASE LKAAERA                     467
//

If you have problems or comments...

PBIL Back to PBIL home page