(data stored in ACNUC7421 zone)

EMBL: CP001630.PE459

CP001630.PE459       Location/Qualifiers
FT   CDS             507285..507758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0466"
FT                   /product="molybdenum cofactor biosynthesis protein C"
FT                   /note="TIGRFAM: molybdenum cofactor biosynthesis protein C;
FT                   PFAM: molybdopterin cofactor biosynthesis MoaC region;
FT                   KEGG: eli:ELI_06520 molybdopterin cofactor biosynthesis
FT                   MoaC region"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34433"
FT                   /db_xref="GOA:C6WHY2"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHY2"
FT                   /inference="protein motif:TFAM:TIGR00581"
FT                   /protein_id="ACU34433.1"
FT                   /translation="MSQFTHIDASGAARMVDVTDKPATARTAVATGVLRTTAEVVRLLA
FT                   ADDLPKGDALATARIAGIMAAKRTSELVPLCHPIALSGVKVDLELGEAEVRVTATVRTA
FT                   DRTGVEMEALTAVSVAGLALHDMVKAVDPAASMDAVRVERKEGGKTGLWERPA"
     MSQFTHIDAS GAARMVDVTD KPATARTAVA TGVLRTTAEV VRLLAADDLP KGDALATARI        60
     AGIMAAKRTS ELVPLCHPIA LSGVKVDLEL GEAEVRVTAT VRTADRTGVE MEALTAVSVA       120
     GLALHDMVKA VDPAASMDAV RVERKEGGKT GLWERPA                                157
//

If you have problems or comments...

PBIL Back to PBIL home page